Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2160 bp · LXL04_036782|LXL04_036782|OH1004|cDNA
ATGTCGCAGAATTGGGAAGCTGATAAAATGCTGGATGTTTACATCCATGACTATATGTTGAAAAGGAAGATGCATGCATCCGCTAAAGCTTTCATGACAGAAGGGAAGGTTGCAACAGACCCTGTCGGTATGGTGTTCTCATGTGTAAACAATCATTCTAATTATGAAAATCTGCAATTTGAAATTGAGTCTCCAATATCTTTTGAGTTTTCAGCTATTGATGCTCCTGGTGGATTTCTCCTGGAATGGTGGTCTGTCTT...
2160 bp · LXL04_036782|LXL04_036782|OH1004|CDS
ATGTCGCAGAATTGGGAAGCTGATAAAATGCTGGATGTTTACATCCATGACTATATGTTGAAAAGGAAGATGCATGCATCCGCTAAAGCTTTCATGACAGAAGGGAAGGTTGCAACAGACCCTGTCGGTATGGTGTTCTCATGTGTAAACAATCATTCTAATTATGAAAATCTGCAATTTGAAATTGAGTCTCCAATATCTTTTGAGTTTTCAGCTATTGATGCTCCTGGTGGATTTCTCCTGGAATGGTGGTCTGTCTT...
Protein
Download Protein FASTA719 aa · LXL04_036782|LXL04_036782|OH1004|PROTEIN
MSQNWEADKMLDVYIHDYMLKRKMHASAKAFMTEGKVATDPVGMVFSCVNNHSNYENLQFEIESPISFEFSAIDAPGGFLLEWWSVFWDIFIARTNEKHSESAATYIETQQIKAKEHQQKMQMQQLHLMQQRNAHLQRRDSSHHPPLGASVNADVMMMGKPPASSTLGLKMQEELMKSATNQQGLLIPGSSQNVSSTLQQIQGRPEIKQEVNLGDSQKPLTTDPSSFYRQAILQSKSGLGGVGFNQGVTSFPLKGWPLTG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036782 |
|---|---|
| TK1151 ID | TkA04G024700 |
| OH-1004 ID | LXL04_036782 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 93.100 |
| Protein coverage (%) | TK1151 98.364 / OH-1004 62.587Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036782 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:48251030-48255995 (-) | |||||||||
| Description | Similar to LUH: Transcriptional corepressor LEUNIG_HOMOLOG | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001666 response to hypoxia Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006974 DNA damage response Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009414 response to water deprivation Biological Process GO:0009611 response to wounding Biological Process GO:0009617 response to bacterium Biological Process GO:0009620 response to fungus Biological Process GO:0009624 response to nematode Biological Process GO:0009733 response to auxin Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process | |||||||||
| KEGG gene cross-reference | ana:alr3466 ath:AT2G32700 ath:AT4G32551 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08513.18LisH9-35 aaPF30097.1LisH_SSDP11-94 aaPF24817.2WD40_WDHD1_1st409-557 aaPF25168.2Beta-prop_WDR36-Utp21_2nd417-546 aaPF25172.2Beta-prop_WDR3_2nd419-572 aaPF24782.3WD40_MABP1-WDR62_2nd428-649 aaPF23414.2Beta-prop_EML_2436-560 aaPF24807.2WD40_CDC20-Fz440-564 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_036782 | PF08513.18 | LisH | 9 | 35 | 4.7e-06 | 27.1 |
| LXL04_036782 | PF30097.1 | LisH_SSDP | 11 | 94 | 7e-20 | 71.9 |
| LXL04_036782 | PF24817.2 | WD40_WDHD1_1st | 409 | 557 | 1.1e-26 | 94.4 |
| LXL04_036782 | PF25168.2 | Beta-prop_WDR36-Utp21_2nd | 417 | 546 | 4.1e-16 | 59.9 |
| LXL04_036782 | PF25172.2 | Beta-prop_WDR3_2nd | 419 | 572 | 1.5e-23 | 84.2 |
| LXL04_036782 | PF24782.3 | WD40_MABP1-WDR62_2nd | 428 | 649 | 4.2e-10 | 39.8 |
| LXL04_036782 | PF23414.2 | Beta-prop_EML_2 | 436 | 560 | 7e-24 | 85.3 |
| LXL04_036782 | PF24807.2 | WD40_CDC20-Fz | 440 | 564 | 1e-24 | 88.1 |
| LXL04_036782 | PF24814.2 | WD40_Prp19 | 441 | 712 | 2.9e-37 | 129.0 |
| LXL04_036782 | PF25175.2 | Beta-prop_WDR5 | 442 | 568 | 2e-50 | 172.4 |
| LXL04_036782 | PF25174.2 | Beta-prop_THOC3 | 442 | 564 | 1.1e-39 | 136.8 |
| LXL04_036782 | PF23381.2 | Beta-prop_IFT122_1st | 442 | 476 | 9.1e-38 | 130.9 |
| LXL04_036782 | PF25173.2 | Beta-prop_WDR3_1st | 442 | 556 | 2.4e-36 | 125.9 |
| LXL04_036782 | PF25047.1 | Beta-prop_TEP1_2nd | 442 | 533 | 9.5e-13 | 48.6 |
| LXL04_036782 | PF00400.39 | WD40 | 443 | 470 | 1.3e-31 | 108.4 |
| LXL04_036782 | PF25391.2 | WD40_Gbeta | 445 | 547 | 1.3e-17 | 64.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.