LXL04_036731 | RubberDandelionOmics

Gene overview

LXL04_036731

Reference: OH-1004 Chr: Chr08 Coordinates: 47401142-47402473 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1188 bp · LXL04_036731|LXL04_036731|OH1004|cDNA

ATGGACGACGATCAAATTCCGGTGTTAGACCTCCGGCAATTAAAAGTCGTATCGGCGCTAGGTCGAGGAGCTAGGGGAGTTGTGTTTTTGGTGCAAGATGAGTTGTCTAATGGAGAATTCTTTGCTTTGAAGACTATTTTGAGAGGTTCGGTTGCGAGGAAAGTGAAGAAGACGGATGACGATGGTGGTGAGTGTAAGCAAATTTTGCTCGAGCAGGAGGTGTTGCGACTGTCGGAACATCCGTTGTTACCGAAACTCCG...

CDS

Download CDS FASTA

1188 bp · LXL04_036731|LXL04_036731|OH1004|CDS

ATGGACGACGATCAAATTCCGGTGTTAGACCTCCGGCAATTAAAAGTCGTATCGGCGCTAGGTCGAGGAGCTAGGGGAGTTGTGTTTTTGGTGCAAGATGAGTTGTCTAATGGAGAATTCTTTGCTTTGAAGACTATTTTGAGAGGTTCGGTTGCGAGGAAAGTGAAGAAGACGGATGACGATGGTGGTGAGTGTAAGCAAATTTTGCTCGAGCAGGAGGTGTTGCGACTGTCGGAACATCCGTTGTTACCGAAACTCCG...

Protein

Download Protein FASTA

395 aa · LXL04_036731|LXL04_036731|OH1004|PROTEIN

MDDDQIPVLDLRQLKVVSALGRGARGVVFLVQDELSNGEFFALKTILRGSVARKVKKTDDDGGECKQILLEQEVLRLSEHPLLPKLRGVLSTESIVGYAIDYCPGRDLNCLRKRQTERMFSDDIIRFYAAELVIALEYLHGLGIVYRDLKPENVMIQENGHLMLVDFDLSTKLSPKPPSVPRSPNPTTSPESEPLLKNKKRFSFFSSCFRPAIPAEDSVHPAESVDNSEQTCARHSFSKSNSFVGTEEYVAPEMLHGNGH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036731`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036731

Location Chr08:47401142-47402473 (-)

Description Similar to OXI1: Serine/threonine-protein kinase OXI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25250`	Involved in oxidative burst-mediated signaling.	OXI1 kinase is necessary for oxidative burst-mediated signalling in Arabidopsis.2004 · DOI: 10.1038/nature02353 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x
`At1g51170`	Regulates planar ovule integument development by suppressing aberrantly oriented growth.	No verified direct reference in this release
`At3g20830`	Regulates planar ovule integument development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0291600`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release
`UniProt: A2YBX5`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036731 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0036290 protein trans-autophosphorylation Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0051782 negative regulation of cell division Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0080060 integument development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G51170

ath:AT3G20830

ath:AT3G25250

dosa:Os06g0291600

osa:4340792

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.619

Rank 1 · LXL04_036731 · OH-1004

Nucleus0.452

Rank 2 · LXL04_036731 · OH-1004

Cell membrane0.063

Rank 3 · LXL04_036731 · OH-1004

Mitochondrion0.054

Rank 4 · LXL04_036731 · OH-1004

Endoplasmic reticulum0.038

Rank 5 · LXL04_036731 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr15-174 aa

PF00069.32Pkinase16-177 aa

PF00069.32Pkinase238-336 aa

PF07714.24PK_Tyr_Ser-Thr247-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036731	`PF07714.24`	PK_Tyr_Ser-Thr	15	174	5.3e-21	75.8
LXL04_036731	`PF00069.32`	Pkinase	16	177	4.4e-52	177.8
LXL04_036731	`PF00069.32`	Pkinase	238	336	4.4e-52	177.8
LXL04_036731	`PF07714.24`	PK_Tyr_Ser-Thr	247	331	5.3e-21	75.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSF1`	Arabidopsis thaliana	Serine/threonine-protein kinase OXI1	54.569%	Swiss-Prot	strong database homology
`Q9SYB9`	Arabidopsis thaliana	Serine/threonine-protein kinase UCN	44.086%	Swiss-Prot	moderate database homology
`Q9LT38`	Arabidopsis thaliana	Serine/threonine-protein kinase UCNL	41.953%	Swiss-Prot	moderate database homology
`Q0DCT8`	Oryza sativa subsp. japonica	Protein kinase G11A	37.240%	Swiss-Prot	moderate database homology
`A2YBX5`	Oryza sativa subsp. indica	Protein kinase G11A	36.979%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card