LXL04_036713 | RubberDandelionOmics

Gene overview

LXL04_036713

Reference: OH-1004 Chr: Chr08 Coordinates: 46932434-46934858 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1502 bp · LXL04_036713|LXL04_036713|OH1004|cDNA

AAAAGACAGAGACAACTATCGTGCCCATACTATGAATATAACCCCAAAAATAATAcatcaaaaaataaaaatcaattttttAATCTTTTATATCTTCTTATCGTCGTTTCTTCATTCTTCCTCCCCCCTCCACCATCTTCGCCGGTAAAACCCAATTCACCCACCGGCGAGAAGCCTCCGCCACAGTTACCCTCAACCTCTCACAAATGGCGTCGTCAATCCCCTACCTTCCAGTATCGCCGCCGCTCAATTACCACACA...

CDS

Download CDS FASTA

1296 bp · LXL04_036713|LXL04_036713|OH1004|CDS

ATGGCGTCGTCAATCCCCTACCTTCCAGTATCGCCGCCGCTCAATTACCACACAACCACTTCAATTCACAAACCCCTCGTCTTCTTCCCCAATCCCACAAACTCCCTCTCGTTAAAATCAATGAATCAAAGCCCCCATTTTTCTTCTCCCGTAAGAAGAAAATCGTCTTCCATCGGTGCCGGTGCGTCCGCGGCAACCGCGTGCTCCACGTCGTACCCGTTCATCGGTAAAGTCGGGCTGCATAGAAGAGAAGGTAACTT...

Protein

Download Protein FASTA

431 aa · LXL04_036713|LXL04_036713|OH1004|PROTEIN

MASSIPYLPVSPPLNYHTTTSIHKPLVFFPNPTNSLSLKSMNQSPHFSSPVRRKSSSIGAGASAATACSTSYPFIGKVGLHRREGNFILLSYGTNPNTGSTMAVKADVSQILSAMLPFVVALTAIAALTQPLTFTWVSKELYAPALGGIMLSIGIKLSIEDFALAFKRPVPLSIGFLAQYVLKPVLGVFIAKSFGMSPMYYAGFVLMSCVAGAQLSSYASFLSKGDVALSILLTSSSTVASVLITPLLTGLLIGSVVPVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036713`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036713

Location Chr08:46932434-46934858 (+)

Description Similar to BASS3: Probable sodium/metabolite cotransporter BASS3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25410`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release
`At4g22840`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0475400`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release
`Os09g0520600`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release
`UniProt: B8BDK4`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036713 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0043879 glycolate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G25410

ath:AT4G22840

dosa:Os02g0475400

dosa:Os09g0520600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.982

Rank 1 · LXL04_036713 · OH-1004

Nucleus0.019

Rank 2 · LXL04_036713 · OH-1004

Peroxisome0.018

Rank 3 · LXL04_036713 · OH-1004

Mitochondrion0.018

Rank 4 · LXL04_036713 · OH-1004

Cytoplasm0.016

Rank 5 · LXL04_036713 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01758.22SBF144-322 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036713	`PF01758.22`	SBF	144	322	4e-35	122.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXE8`	Arabidopsis thaliana	Probable sodium/metabolite cotransporter BASS3, chloroplastic	72.775%	Swiss-Prot	strong database homology
`Q8VYY4`	Arabidopsis thaliana	Probable sodium/metabolite cotransporter BASS6, chloroplastic	39.080%	Swiss-Prot	moderate database homology
`Q6K739`	Oryza sativa subsp. japonica	Probable sodium/metabolite cotransporter BASS3, chloroplastic	71.745%	Swiss-Prot	strong database homology
`Q650U0`	Oryza sativa subsp. japonica	Probable sodium/metabolite cotransporter BASS5, chloroplastic	41.824%	Swiss-Prot	moderate database homology
`B8BDK4`	Oryza sativa subsp. indica	Probable sodium/metabolite cotransporter BASS5, chloroplastic	41.824%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card