LXL04_036683 | RubberDandelionOmics

Gene overview

LXL04_036683

Reference: OH-1004 Chr: Chr08 Coordinates: 46630896-46633444 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1140 bp · LXL04_036683|LXL04_036683|OH1004|cDNA

ATGCTCAAGATGATACCCATGATGAAATTACTAGTTAATCTTCCATTTTTGTTGCTTATAACAACTAATCATCTTTCACTACATATGATCCATGGACAAACCCAAGATTCATGTGGTTCGAACTCGAATCTTGCTAATATCAGTAGCCAGATCTTCTTTGAGACTTCTTCTCTCAATTGCTTTCCTGTTTGGTCTTCGGAAAACTTCATCCTTAGATATTCACAAGATGGCCCAAGTTTGTGGAATTTTGTCTTATCGGC...

CDS

Download CDS FASTA

1140 bp · LXL04_036683|LXL04_036683|OH1004|CDS

ATGCTCAAGATGATACCCATGATGAAATTACTAGTTAATCTTCCATTTTTGTTGCTTATAACAACTAATCATCTTTCACTACATATGATCCATGGACAAACCCAAGATTCATGTGGTTCGAACTCGAATCTTGCTAATATCAGTAGCCAGATCTTCTTTGAGACTTCTTCTCTCAATTGCTTTCCTGTTTGGTCTTCGGAAAACTTCATCCTTAGATATTCACAAGATGGCCCAAGTTTGTGGAATTTTGTCTTATCGGC...

Protein

Download Protein FASTA

379 aa · LXL04_036683|LXL04_036683|OH1004|PROTEIN

MLKMIPMMKLLVNLPFLLLITTNHLSLHMIHGQTQDSCGSNSNLANISSQIFFETSSLNCFPVWSSENFILRYSQDGPSLWNFVLSAPISNSYIGMGFSPNGGMVGSSAVVGWVARDGSGNMKKYFLGGQSPSQVLVDQGDLEVIGNTSLVISDSSRIFMVFQLLIDQPRRQLVFSVGDSSNPPPNTPNFLLTRHRSHMAISLNYASGQSSRIKAPYSNLKRAHGALNMIGWGILIPIGAMVARYLKHLNPLWFYIHTGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036683`
TK1151 ID	TkA04G029420
OH-1004 ID	LXL04_036683
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036683

Location Chr08:46630896-46633444 (-)

Description Similar to At3g07570: Cytochrome b561 and DOMON domain-containing protein At3g07570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07570`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At3g61750`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At5g35735`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At5g47530`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At3g59070`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036683 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0080022 primary root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0000293 ferric-chelate reductase activity Molecular Function

GO:0009055 electron transfer activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G07570

ath:AT3G59070

ath:AT3G61750

ath:AT5G35735

ath:AT5G47530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.624

Rank 1 · LXL04_036683 · OH-1004

Lysosome / Vacuole0.193

Rank 2 · LXL04_036683 · OH-1004

Cytoplasm0.121

Rank 3 · LXL04_036683 · OH-1004

Endoplasmic reticulum0.089

Rank 4 · LXL04_036683 · OH-1004

Golgi apparatus0.060

Rank 5 · LXL04_036683 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03351.23DOMON83-144 aa

PF03188.22Cytochrom_B561224-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036683	`PF03351.23`	DOMON	83	144	2.2e-08	35.1
LXL04_036683	`PF03188.22`	Cytochrom_B561	224	344	2.8e-06	28.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WRW8`	Arabidopsis thaliana	Cytochrome b561 and DOMON domain-containing protein At3g07570	51.009%	Swiss-Prot	strong database homology
`Q9M363`	Arabidopsis thaliana	Cytochrome b561 and DOMON domain-containing protein At3g61750	37.838%	Swiss-Prot	moderate database homology
`Q9FKH6`	Arabidopsis thaliana	Cytochrome b561 and DOMON domain-containing protein At5g35735	28.125%	Swiss-Prot	weak database homology
`Q9FGK4`	Arabidopsis thaliana	Cytochrome b561 and DOMON domain-containing protein At5g47530	32.155%	Swiss-Prot	moderate database homology
`Q9LYS9`	Arabidopsis thaliana	Cytochrome b561 and DOMON domain-containing protein At3g59070	31.475%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card