LXL04_036669 | RubberDandelionOmics

Gene overview

LXL04_036669

Reference: OH-1004 Chr: Chr08 Coordinates: 46462844-46464078 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

668 bp · LXL04_036669|LXL04_036669|OH1004|cDNA

atgaacaagcctccgttcgtgttcgttcggttcgtttacgGCCCGTCCATCGCTACTTTCACCACTCTCCTCTTTCCGTTCATCCATAGCACTCCGCCCAGCCGTCGCCGCCGCTCGTTTCCATATCACAAGAGCTTCATTTGGTTCATCCACTCAGACTGTAGATGGAGGCGGAACATTATAAATTTGGACCGTACAAAATTGACCCAAAGGAAGTGTTTTACTCTACTGATCTTTCATATGCTTTGGTCAATCTCCGC...

CDS

Download CDS FASTA

618 bp · LXL04_036669|LXL04_036669|OH1004|CDS

ATGAACAAGCCTCCGTTCGTGTTCGTTCGGTTCGTTTACGGCCCGTCCATCGCTACTTTCACCACTCTCCTCTTTCCGTTCATCCATAGCACTCCGCCCAGCCGTCGCCGCCGCTCGTTTCCATATCACAAGAGCTTCATTTGGTTCATCCACTCAGACTGTAGATGGAGGCGGAACATTATAAATTTGGACCGTACAAAATTGACCCAAAGGAAGTGTTTTACTCTACTGATCTTTCATATGCTTTGGTCAATCTCCGC...

Protein

Download Protein FASTA

205 aa · LXL04_036669|LXL04_036669|OH1004|PROTEIN

MNKPPFVFVRFVYGPSIATFTTLLFPFIHSTPPSRRRRSFPYHKSFIWFIHSDCRWRRNIINLDRTKLTQRKCFTLLIFHMLWSISALFFLVISLNKYKLGSLAYTREVKRFVDLTTEETSDLWISAQKIGKQLENHHKASSLTFAIQDGPQAGQTVPHVHIHIVPRKGGDFENNDEIYDAIDEKEKELKNTLDLDKERKDRSME

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036669`
TK1151 ID	TkA04G029780
OH-1004 ID	LXL04_036669
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.100
Protein coverage (%)	TK1151 81.757 / OH-1004 63.902 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036669

Location Chr08:46462844-46464078 (+)

Description Similar to FHIT: Bifunctional bis(5'-adenosyl)-triphosphatase/adenylylsulfatase FHIT

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58240`	Possesses dinucleoside triphosphate hydrolase activity.	Fhit proteins can also recognize substrates other than dinucleoside polyphosphates.2008 · DOI: 10.1016/j.febslet.2008.07.060

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036669 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002188 translation reinitiation Biological Process

GO:0006163 purine nucleotide metabolic process Biological Process

GO:0006260 DNA replication Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0015964 diadenosine triphosphate catabolic process Biological Process

GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G58240

bta:692183

ddi:DDB_G0274257

hsa:2272

rno:60398

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.344

Rank 1 · LXL04_036669 · OH-1004

Mitochondrion0.298

Rank 2 · LXL04_036669 · OH-1004

Nucleus0.214

Rank 3 · LXL04_036669 · OH-1004

Peroxisome0.116

Rank 4 · LXL04_036669 · OH-1004

Plastid0.086

Rank 5 · LXL04_036669 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01230.30HIT107-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036669	`PF01230.30`	HIT	107	168	9e-16	59.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KEV7`	Arabidopsis thaliana	Bifunctional bis(5'-adenosyl)-triphosphatase/adenylylsulfatase FHIT	76.768%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card