LXL04_036642 | RubberDandelionOmics

Gene overview

LXL04_036642

Reference: OH-1004 Chr: Chr08 Coordinates: 45841057-45847267 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3084 bp · LXL04_036642|LXL04_036642|OH1004|cDNA

ATGGCGGTCGGCGGTTGTACTTTCTCGTCGGACGATATCGTAGTGAAGTCGCCGAACGATAGGCGGTTATACAGATACATACAGCTCCCGAACGGCCTCTGTGCTTTGCTTGTGCATGATCCTGATATTTATAAGGACGGCACACCGGACAGCGCCAAACCTGAGGGAACGAGCGAGGATGATGACGATGAAGAAGACGACGAGGATGATGAGGAAGAAAGCggagatgaagatgatgaaggagAAGACGACGACGAAGA...

CDS

Download CDS FASTA

3084 bp · LXL04_036642|LXL04_036642|OH1004|CDS

ATGGCGGTCGGCGGTTGTACTTTCTCGTCGGACGATATCGTAGTGAAGTCGCCGAACGATAGGCGGTTATACAGATACATACAGCTCCCGAACGGCCTCTGTGCTTTGCTTGTGCATGATCCTGATATTTATAAGGACGGCACACCGGACAGCGCCAAACCTGAGGGAACGAGCGAGGATGATGACGATGAAGAAGACGACGAGGATGATGAGGAAGAAAGCGGAGATGAAGATGATGAAGGAGAAGACGACGACGAAGA...

Protein

Download Protein FASTA

1027 aa · LXL04_036642|LXL04_036642|OH1004|PROTEIN

MAVGGCTFSSDDIVVKSPNDRRLYRYIQLPNGLCALLVHDPDIYKDGTPDSAKPEGTSEDDDDEEDDEDDEEESGDEDDEGEDDDEEGESAKSNAPQTKKAAAAMCVGMGSFSDPLEAQGLAHFLEHMLFMGSAEFPDENEYDSYLSKHGGSSNAYTEVEHTCYHFEVKPEFLEGALRRFSQFFISPLVKTEAMDREVLAVDSEFNQALQSDACRLQQLQCHTAAPGHAFNQFFWGNKKSLSDAVEKGVNLRDQILKFYN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036642`
TK1151 ID	TkA04G032680
OH-1004 ID	LXL04_036642
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036642

Location Chr08:45841057-45847267 (-)

Description Similar to At1g06900: Nardilysin-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06900`	Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036642 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0010815 bradykinin catabolic process Biological Process

GO:0010992 ubiquitin recycling Biological Process

GO:0019885 antigen processing and presentation of endogenous peptide antigen via MHC class I Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0032092 positive regulation of protein binding Biological Process

GO:0032760 positive regulation of tumor necrosis factor production Biological Process

GO:0042447 hormone catabolic process Biological Process

GO:0043171 peptide catabolic process Biological Process

GO:0045732 positive regulation of protein catabolic process Biological Process

GO:0045861 negative regulation of proteolysis Biological Process

KEGG gene cross-reference

ath:AT1G06900

bta:523752

hsa:3416

hsa:4898

rno:25700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.582

Rank 1 · LXL04_036642 · OH-1004

Nucleus0.413

Rank 2 · LXL04_036642 · OH-1004

Mitochondrion0.085

Rank 3 · LXL04_036642 · OH-1004

Cell membrane0.054

Rank 4 · LXL04_036642 · OH-1004

Endoplasmic reticulum0.045

Rank 5 · LXL04_036642 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00675.26Peptidase_M1693-226 aa

PF05193.27Peptidase_M16_C252-432 aa

PF16187.11Peptidase_M16_M439-728 aa

PF05193.27Peptidase_M16_C733-917 aa

PF22456.2PqqF-like_C_4838-937 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036642	`PF00675.26`	Peptidase_M16	93	226	6.7e-35	120.9
LXL04_036642	`PF05193.27`	Peptidase_M16_C	252	432	4e-42	144.9
LXL04_036642	`PF16187.11`	Peptidase_M16_M	439	728	1.9e-90	303.6
LXL04_036642	`PF05193.27`	Peptidase_M16_C	733	917	4e-42	144.9
LXL04_036642	`PF22456.2`	PqqF-like_C_4	838	937	9.9e-27	93.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HNU6`	Arabidopsis thaliana	Nardilysin-like	66.602%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card