LXL04_036604 | RubberDandelionOmics

Gene overview

LXL04_036604

Reference: OH-1004 Chr: Chr08 Coordinates: 45225544-45227713 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1227 bp · LXL04_036604|LXL04_036604|OH1004|cDNA

ATGCTTCGCTGTCCGAAGGTACACATATGTGTAGTCCCCATGCATAACTGTCTACTCTTCTTTGGGAAGCGTTATCCCATAATCTATGATTATGTCCAATCCGTTGTACTTGGATTTACCATGACAATCATTATTTCTCGTGTAATGTTTCATTCCTTTGTTACTTGTCCCGGAGACCTCGTCTTTCAAATGGGCTCGGCGTCGTCCTCCAACTGGGCTCGGCCTCGGCCTTCAACTGGGCTCGGCCTCGGCTCCCTTCT...

CDS

Download CDS FASTA

1227 bp · LXL04_036604|LXL04_036604|OH1004|CDS

ATGCTTCGCTGTCCGAAGGTACACATATGTGTAGTCCCCATGCATAACTGTCTACTCTTCTTTGGGAAGCGTTATCCCATAATCTATGATTATGTCCAATCCGTTGTACTTGGATTTACCATGACAATCATTATTTCTCGTGTAATGTTTCATTCCTTTGTTACTTGTCCCGGAGACCTCGTCTTTCAAATGGGCTCGGCGTCGTCCTCCAACTGGGCTCGGCCTCGGCCTTCAACTGGGCTCGGCCTCGGCTCCCTTCT...

Protein

Download Protein FASTA

408 aa · LXL04_036604|LXL04_036604|OH1004|PROTEIN

MLRCPKVHICVVPMHNCLLFFGKRYPIIYDYVQSVVLGFTMTIIISRVMFHSFVTCPGDLVFQMGSASSSNWARPRPSTGLGLGSLLLEGKVKEKKERGRTCTRRQPPSKDTQMAGRNYIPPDALKFRQDSHSRRAPIESPPRHHHHVEDRIAVHHREIQSLLSDNQRLAATHVALKQEMSLSVQELRHLSSAASNVKAERDAEVREVYEKAVKMEAEARLIDELSAELIQVRGDIQKLSSERKELNEKLDKVNGDLAKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036604`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036604

Location Chr08:45225544-45227713 (-)

Description Similar to FLX: Protein FLC EXPRESSOR

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30120`	Transactivator required for FRIGIDA-mediated activation of FLC and for the expression of the repressors of flowering AGL27/MAF1 and AGL31/MAF2.	No verified direct reference in this release
`At3g14750`	Has no transcriptional activation activity.	No verified direct reference in this release
`At1g67170`	Has no transcriptional activation activity.	No verified direct reference in this release
`At1g55170`	Has no transcriptional activation activity.	No verified direct reference in this release
`At5g61920`	Involved in FLC activation and flowering time control, but has no transcriptional activation activity.	Two FLX family members are non-redundantly required to establish the vernalization requirement in Arabidopsis.2013 · DOI: 10.1038/ncomms3186

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036604 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016604 nuclear body Cellular Component

KEGG gene cross-reference

ath:AT1G55170

ath:AT1G67170

ath:AT2G30120

ath:AT3G14750

ath:AT5G61920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.496

Rank 1 · LXL04_036604 · OH-1004

Nucleus0.375

Rank 2 · LXL04_036604 · OH-1004

Cell membrane0.208

Rank 3 · LXL04_036604 · OH-1004

Endoplasmic reticulum0.072

Rank 4 · LXL04_036604 · OH-1004

Golgi apparatus0.048

Rank 5 · LXL04_036604 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IMQ0`	Arabidopsis thaliana	Protein FLC EXPRESSOR	42.023%	Swiss-Prot	moderate database homology
`Q93V84`	Arabidopsis thaliana	Protein FLX-like 1	42.781%	Swiss-Prot	weak database homology
`Q84TD8`	Arabidopsis thaliana	Protein FLX-like 2	33.462%	Swiss-Prot	moderate database homology
`Q9C717`	Arabidopsis thaliana	Protein FLX-like 3	38.660%	Swiss-Prot	weak database homology
`Q9FH51`	Arabidopsis thaliana	Protein FLX-like 4	29.146%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card