LXL04_036600 | RubberDandelionOmics

Gene overview

LXL04_036600

Reference: OH-1004 Chr: Chr08 Coordinates: 45138639-45144989 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

528 bp · LXL04_036600|LXL04_036600|OH1004|cDNA

ATGCTCGTCGGCGAAGCCTGCTTCATCGATGCCGACTCCACCACTCACTTGAAGTATCATGTCAAGTATTGGGTTGGAATGATGCGGGGTAGAAAGAGCATGGATTCATATTATCAATACGAGGGAGGTTTTCTGGTGGCTTTTGCTTTTCCTCAAAGGAAGGAGAAATGGAAGTACTGGATGGCTATCAAGGTACATAGCGGTGAAAATTTCCATGTTAATCTTCACACCGGAGAGACTTTGCACATCACACAGGCTAG...

CDS

Download CDS FASTA

528 bp · LXL04_036600|LXL04_036600|OH1004|CDS

ATGCTCGTCGGCGAAGCCTGCTTCATCGATGCCGACTCCACCACTCACTTGAAGTATCATGTCAAGTATTGGGTTGGAATGATGCGGGGTAGAAAGAGCATGGATTCATATTATCAATACGAGGGAGGTTTTCTGGTGGCTTTTGCTTTTCCTCAAAGGAAGGAGAAATGGAAGTACTGGATGGCTATCAAGGTACATAGCGGTGAAAATTTCCATGTTAATCTTCACACCGGAGAGACTTTGCACATCACACAGGCTAG...

Protein

Download Protein FASTA

175 aa · LXL04_036600|LXL04_036600|OH1004|PROTEIN

MLVGEACFIDADSTTHLKYHVKYWVGMMRGRKSMDSYYQYEGGFLVAFAFPQRKEKWKYWMAIKVHSGENFHVNLHTGETLHITQASLGRYTETKEAIYLQLEIDGKVTVVGTLLPNKLQQQQMKLVFNRKFHISHTNTNDIIHLYEILIKRPQYNHGYPFFKYIYWNFLILYLT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036600`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036600

Location Chr08:45138639-45144989 (+)

Description Similar to HDT1: Histone deacetylase HDT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22650`	Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4).	Repression of gene expression by Arabidopsis HD2 histone deacetylases.2003 · DOI: 10.1046/j.1365-313x.2003.01714.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036600 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0010162 seed dormancy process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009505 plant-type cell wall Cellular Component

KEGG gene cross-reference

ath:AT5G22650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.462

Rank 1 · LXL04_036600 · OH-1004

Nucleus0.442

Rank 2 · LXL04_036600 · OH-1004

Mitochondrion0.095

Rank 3 · LXL04_036600 · OH-1004

Endoplasmic reticulum0.073

Rank 4 · LXL04_036600 · OH-1004

Cell membrane0.064

Rank 5 · LXL04_036600 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17800.8NPL62-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036600	`PF17800.8`	NPL	62	145	6.5e-12	46.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56WH4`	Arabidopsis thaliana	Histone deacetylase HDT2	35.938%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card