Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1452 bp · LXL04_036565|LXL04_036565|OH1004|cDNA
ATGGACATGTTTGAAAGGAAAGCGAACCGGGGCCCTACGTCCCTCCCGCTTTTCGGTGTTCTTCTCGTCGTTCTCGTTATCACCGGCGTCTTCCTCCTTGCGgtggaCAACTTGGCAAcgcagaccaaaaccatcatTGGTTACAACTTAAAACCAACGCCTTGGCATGAATTCCCTGCCAAAAACTTCAACAACGAAACAAAGATCGCCCGAGCTTCCAAAATCATACAATGCTCTTACCTTTCCTGTGGAATTTTATC...
1452 bp · LXL04_036565|LXL04_036565|OH1004|CDS
ATGGACATGTTTGAAAGGAAAGCGAACCGGGGCCCTACGTCCCTCCCGCTTTTCGGTGTTCTTCTCGTCGTTCTCGTTATCACCGGCGTCTTCCTCCTTGCGGTGGACAACTTGGCAACGCAGACCAAAACCATCATTGGTTACAACTTAAAACCAACGCCTTGGCATGAATTCCCTGCCAAAAACTTCAACAACGAAACAAAGATCGCCCGAGCTTCCAAAATCATACAATGCTCTTACCTTTCCTGTGGAATTTTATC...
Protein
Download Protein FASTA483 aa · LXL04_036565|LXL04_036565|OH1004|PROTEIN
MDMFERKANRGPTSLPLFGVLLVVLVITGVFLLAVDNLATQTKTIIGYNLKPTPWHEFPAKNFNNETKIARASKIIQCSYLSCGILSLNDQIPFTRKIERCPRFFRWIHHDLEPWSKTGITHDHLMEVKQFASFRIVIISGKLYVDYYYDCVQSRAMFTIWGFLQLLKRYPGRIPDVDMMFDCMDKPLIERNSSTTPLPIFRYCTTPEHYDIPFPDWSFWGWPEINIGPWQDEFESIKEGSQKQSWRNKHPYAYWRGNPD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036565 |
|---|---|
| TK1151 ID | TkA04G036920 |
| OH-1004 ID | LXL04_036565 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036565 |
|---|---|
| Location | Chr08:44594791-44596608 (+) |
| Description | Similar to AGAP004267: O-glucosyltransferase rumi homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006493 protein O-linked glycosylation Biological Process GO:0008593 regulation of Notch signaling pathway Biological Process GO:0045747 positive regulation of Notch signaling pathway Biological Process GO:0180059 protein O-linked glycosylation via glucose Biological Process GO:0180064 protein O-linked glycosylation via xylose Biological Process GO:0005576 extracellular region Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005788 endoplasmic reticulum lumen Cellular Component GO:0012505 endomembrane system Cellular Component GO:0035251 UDP-glucosyltransferase activity Molecular Function GO:0035252 UDP-xylosyltransferase activity Molecular Function GO:0046527 glucosyltransferase activity Molecular Function |
| KEGG gene cross-reference | aga:4576887 bta:511862 cqu:CpipJ_CPIJ013394 hsa:56983 rno:288091 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05686.19Glyco_transf_9098-478 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_036565 | PF05686.19 | Glyco_transf_90 | 98 | 478 | 4.2e-143 | 477.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.