LXL04_036564 | RubberDandelionOmics

Gene overview

LXL04_036564

Reference: OH-1004 Chr: Chr08 Coordinates: 44590880-44592727 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

615 bp · LXL04_036564|LXL04_036564|OH1004|cDNA

ATGAAGTTACTATCGGCTGCAGTTCTATGCTCTCTACTTCTCATCGGAACCATAGCCCTCACTGAGGCTAAGAAGTCAAACAAAGATTTAACAGAAGTGACTCAGAAAGTCTATTTTGATGTTGAGATTGCTGGAAAACCAGCTGGAAGAATAGTTTTTGGTCTCTTTGGAAAAACAGTTCCCAAAACAGCAGAAAACTTCAGAGCATTATGCACAGgGGAGAAGGGAGTTGGAAAAAGTGGGAAGCCTCTTTACTTCAA...

CDS

Download CDS FASTA

615 bp · LXL04_036564|LXL04_036564|OH1004|CDS

ATGAAGTTACTATCGGCTGCAGTTCTATGCTCTCTACTTCTCATCGGAACCATAGCCCTCACTGAGGCTAAGAAGTCAAACAAAGATTTAACAGAAGTGACTCAGAAAGTCTATTTTGATGTTGAGATTGCTGGAAAACCAGCTGGAAGAATAGTTTTTGGTCTCTTTGGAAAAACAGTTCCCAAAACAGCAGAAAACTTCAGAGCATTATGCACAGGGGAGAAGGGAGTTGGAAAAAGTGGGAAGCCTCTTTACTTCAA...

Protein

Download Protein FASTA

204 aa · LXL04_036564|LXL04_036564|OH1004|PROTEIN

MKLLSAAVLCSLLLIGTIALTEAKKSNKDLTEVTQKVYFDVEIAGKPAGRIVFGLFGKTVPKTAENFRALCTGEKGVGKSGKPLYFKGSAFHRIIPSFMIQGGDFTNGDGTGGESIYGEKFKDENFKIKHTGPGLLSMANAGKNTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKMEAEGSQSGSPKSKVTIADSGELPL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036564`
TK1151 ID	TkA04G036940
OH-1004 ID	LXL04_036564
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036564

Location Chr08:44590880-44592727 (-)

Description Similar to CYP19-4: Peptidyl-prolyl cis-trans isomerase CYP19-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29960`	PPIases accelerate the folding of proteins.	A conserved domain of the arabidopsis GNOM protein mediates subunit interaction and cyclophilin 5 binding.2000 · DOI: 10.1105/tpc.12.3.343
`At5g58710`	PPIases accelerate the folding of proteins.	Mutations in a new Arabidopsis cyclophilin disrupt its interaction with protein phosphatase 2A.1999 · DOI: 10.1007/s004380051147
`At3g55920`	PPIases accelerate the folding of proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036564 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0048364 root development Biological Process

GO:0061083 regulation of protein refolding Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005771 multivesicular body Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005795 Golgi stack Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

KEGG gene cross-reference

ath:AT2G29960

ath:AT3G55920

ath:AT5G58710

cel:CELE_Y75B12B.2

ddi:DDB_G0269120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.256

Rank 1 · LXL04_036564 · OH-1004

Endoplasmic reticulum0.231

Rank 2 · LXL04_036564 · OH-1004

Lysosome / Vacuole0.224

Rank 3 · LXL04_036564 · OH-1004

Golgi apparatus0.136

Rank 4 · LXL04_036564 · OH-1004

Cytoplasm0.120

Rank 5 · LXL04_036564 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00160.27Pro_isomerase38-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036564	`PF00160.27`	Pro_isomerase	38	198	1.7e-48	165.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LDP4`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase CYP19-4	78.431%	Swiss-Prot	strong database homology
`Q9SP02`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase CYP20-1	81.967%	Swiss-Prot	strong database homology
`Q8L8W5`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase CYP21-2	64.414%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card