Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1929 bp · LXL04_036521|LXL04_036521|OH1004|cDNA
ATGATAATAGATGGGAGAAATTTTCACTTGAAATTCATGCTAAAAGTATTGGTGGAACTAAAGGGTCAGAATGTCAGATACACAAGAATTTTCAAGACTATAATGTTGAGAATAAACAATAAAGTTCTCTTATGTTCTGATGCCACTCCACCGGGTGTCTGGTTGATGGATGGATTCATCAGGTTTGCATGGGGGTTTTCATTGTTCATATGTCTTCTACCAATGTTCAATAACTTGGGTGGAAAAGATGTAGGAGTCAT...
1929 bp · LXL04_036521|LXL04_036521|OH1004|CDS
ATGATAATAGATGGGAGAAATTTTCACTTGAAATTCATGCTAAAAGTATTGGTGGAACTAAAGGGTCAGAATGTCAGATACACAAGAATTTTCAAGACTATAATGTTGAGAATAAACAATAAAGTTCTCTTATGTTCTGATGCCACTCCACCGGGTGTCTGGTTGATGGATGGATTCATCAGGTTTGCATGGGGGTTTTCATTGTTCATATGTCTTCTACCAATGTTCAATAACTTGGGTGGAAAAGATGTAGGAGTCAT...
Protein
Download Protein FASTA642 aa · LXL04_036521|LXL04_036521|OH1004|PROTEIN
MIIDGRNFHLKFMLKVLVELKGQNVRYTRIFKTIMLRINNKVLLCSDATPPGVWLMDGFIRFAWGFSLFICLLPMFNNLGGKDVGVIAFHTHHYNHHTHTHHSMKVKQTYRTGYHFQPKKNWINAPMYYKGIYHLFYQYNPKGAVWGNIVWAHSVSKDMVNWIHLEHAIVPSRPFDKYGCWSGSATILPRNKPVIFYTGIVAPKPAPGHQVQVYAIPANHSDPYLRKWTKPSDNPFLKPTSENISAWRDPTTAWFNNGHW...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036521 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036521 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:43851607-43854891 (+) | |||||||||
| Description | Similar to INV1: Beta-fructofuranosidase, insoluble isoenzyme 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0005982 starch metabolic process Biological Process GO:0005987 sucrose catabolic process Biological Process GO:0048481 plant ovule development Biological Process GO:0071836 nectar secretion Biological Process GO:0009505 plant-type cell wall Cellular Component GO:0048046 apoplast Cellular Component GO:0090406 pollen tube Cellular Component GO:0004564 beta-fructofuranosidase activity Molecular Function GO:0004575 sucrose alpha-glucosidase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G36190 ath:AT3G52600 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00251.27Glyco_hydro_32N115-431 aaPF08244.20Glyco_hydro_32C434-635 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_036521 | PF00251.27 | Glyco_hydro_32N | 115 | 431 | 5e-95 | 319.3 |
| LXL04_036521 | PF08244.20 | Glyco_hydro_32C | 434 | 635 | 2.9e-25 | 89.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.