LXL04_036491 | RubberDandelionOmics

Gene overview

LXL04_036491

Reference: OH-1004 Chr: Chr08 Coordinates: 43275871-43277960 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1221 bp · LXL04_036491|LXL04_036491|OH1004|cDNA

ATGGGCTGTTTCTTATGCTCCGATGGAGATCCTTCTGCTGCGAAAAGCTCACCGAAAAATACGAGAAAGAACAACTCCAAGAACGATAAATCGCATCCCTCTTCTGATAACTCCAAATCGACTCCAACTACCGAATTCAAGAAGGATAACCCTAAAGACTCTAATCAATCATCTGTTGCCAATGAGAACgatgataaaaataaaaacaaatctCCCGACAATAAAGAGCCTAATAAAGCTAAAGTACGAACATTTACATA...

CDS

Download CDS FASTA

1221 bp · LXL04_036491|LXL04_036491|OH1004|CDS

ATGGGCTGTTTCTTATGCTCCGATGGAGATCCTTCTGCTGCGAAAAGCTCACCGAAAAATACGAGAAAGAACAACTCCAAGAACGATAAATCGCATCCCTCTTCTGATAACTCCAAATCGACTCCAACTACCGAATTCAAGAAGGATAACCCTAAAGACTCTAATCAATCATCTGTTGCCAATGAGAACGATGATAAAAATAAAAACAAATCTCCCGACAATAAAGAGCCTAATAAAGCTAAAGTACGAACATTTACATA...

Protein

Download Protein FASTA

406 aa · LXL04_036491|LXL04_036491|OH1004|PROTEIN

MGCFLCSDGDPSAAKSSPKNTRKNNSKNDKSHPSSDNSKSTPTTEFKKDNPKDSNQSSVANENDDKNKNKSPDNKEPNKAKVRTFTYAQLVTATNNFKGAYFLGEGGFGKVYKGKLEDSDQIVAIKQLDLDGSQGIREFVVEVLTLSMAEHPNLVKLIGYCAEAKQRLLVYEFMPFGSLEDHLHGLRLNKKPLDWNARMKIAAGAARGLEYLHDQMNPAVIYRDLKCSNILLNREYHAKLSDFGLAKVGPLGDKTHVSTR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036491`
TK1151 ID	TkA04G041380
OH-1004 ID	LXL04_036491
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036491

Location Chr08:43275871-43277960 (-)

Description Similar to PBL5: Probable serine/threonine-protein kinase PBL5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07870`	May be involved in plant defense signaling.	No verified direct reference in this release
`At2g28590`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g02800`	Serine/threonine-protein kinase involved in the positive regulation of brassinosteroid (BR) signaling and plant growth.	No verified direct reference in this release
`At5g18610`	May act as a receptor-like cytoplasmic kinase in chitin-induced immune signaling.	Selective regulation of the chitin-induced defense response by the Arabidopsis receptor-like cytoplasmic kinase PBL27.2014 · DOI: 10.1111/tpj.12535 The Arabidopsis CERK1-associated kinase PBL27 connects chitin perception to MAPK activation.2016 · DOI: 10.15252/embj.201694248

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0372100`	Functions as an immediate downstream signaling partner of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	A receptor-like cytoplasmic kinase targeted by a plant pathogen effector is directly phosphorylated by the chitin receptor and mediates rice immunity.2013 · DOI: 10.1016/j.chom.2013.02.007

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036491 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0043410 positive regulation of MAPK cascade Biological Process

GO:0045087 innate immune response Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071323 cellular response to chitin Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G07870

ath:AT2G28590

ath:AT5G02800

ath:AT5G18610

dosa:Os05g0372100

osa:4338592

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.779

Rank 1 · LXL04_036491 · OH-1004

Cytoplasm0.183

Rank 2 · LXL04_036491 · OH-1004

Nucleus0.158

Rank 3 · LXL04_036491 · OH-1004

Endoplasmic reticulum0.042

Rank 4 · LXL04_036491 · OH-1004

Golgi apparatus0.024

Rank 5 · LXL04_036491 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase102-367 aa

PF07714.24PK_Tyr_Ser-Thr103-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036491	`PF00069.32`	Pkinase	102	367	5.7e-46	157.7
LXL04_036491	`PF07714.24`	PK_Tyr_Ser-Thr	103	369	1.5e-45	156.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQQ8`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL5	64.484%	Swiss-Prot	strong database homology
`Q9SIB6`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL6	63.171%	Swiss-Prot	strong database homology
`Q0WRY5`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL7	63.130%	Swiss-Prot	strong database homology
`Q1PDV6`	Arabidopsis thaliana	Serine/threonine-protein kinase PBL27	61.917%	Swiss-Prot	strong database homology
`Q6I5Q6`	Oryza sativa subsp. japonica	Receptor-like cytoplasmic kinase 185	59.951%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card