LXL04_036483 | RubberDandelionOmics

Gene overview

LXL04_036483

Reference: OH-1004 Chr: Chr08 Coordinates: 43108678-43109909 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

753 bp · LXL04_036483|LXL04_036483|OH1004|cDNA

ATGTACGGACACACTCACCACATGAATGACACATATACCTTCCCACCGGAATTTCTTGCCGGACCAGGACCGGTGGCATCGCTTTCTCAATCGTATTCCACCGCCGATTGCTTCCTACCACCGCCACCTCTGGCCATTCCGACGTATGAGTTGGACGCCGTGTATGCAACAAGCAGCGGAGGATATGACTCGCCGAGTTATACTGCAAGTCCGAGCATGGTGATTCCGAGAAGCGGTAGCAGCCATTCGGTTACAACTCA...

CDS

Download CDS FASTA

753 bp · LXL04_036483|LXL04_036483|OH1004|CDS

ATGTACGGACACACTCACCACATGAATGACACATATACCTTCCCACCGGAATTTCTTGCCGGACCAGGACCGGTGGCATCGCTTTCTCAATCGTATTCCACCGCCGATTGCTTCCTACCACCGCCACCTCTGGCCATTCCGACGTATGAGTTGGACGCCGTGTATGCAACAAGCAGCGGAGGATATGACTCGCCGAGTTATACTGCAAGTCCGAGCATGGTGATTCCGAGAAGCGGTAGCAGCCATTCGGTTACAACTCA...

Protein

Download Protein FASTA

250 aa · LXL04_036483|LXL04_036483|OH1004|PROTEIN

MYGHTHHMNDTYTFPPEFLAGPGPVASLSQSYSTADCFLPPPPLAIPTYELDAVYATSSGGYDSPSYTASPSMVIPRSGSSHSVTTQFHHNGFFNQPVSSPTELLDSEGSSYTSVRRVFSADDLQGTNMVQNHYHRSDSPLSSESNSIIESMNKACRYSPEEKKERIERYRSKKTQRNFTKKIKYVCRKTLADSRPRIRGRFARNDEIEKAIEDDQCVSQGGGEEGLYEEDDDNWMNNFLDSFPSNLSIP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036483`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036483

Location Chr08:43108678-43109909 (-)

Description Similar to COL3: Zinc finger protein CONSTANS-LIKE 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24790`	Zinc finger protein CONSTANS-LIKE 3.	No verified direct reference in this release
`At5g15850`	Putative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.	No verified direct reference in this release
`At5g57660`	Zinc finger protein CONSTANS-LIKE 5.	No verified direct reference in this release
`At3g02380`	Putative transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0275000`	Probable transcription factor involved in the regulation of flower development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036483 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010161 red light signaling pathway Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048571 long-day photoperiodism Biological Process

GO:0048572 short-day photoperiodism Biological Process

KEGG gene cross-reference

ath:AT2G24790

ath:AT3G02380

ath:AT5G15850

ath:AT5G57660

dosa:Os06g0275000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.870

Rank 1 · LXL04_036483 · OH-1004

Cytoplasm0.311

Rank 2 · LXL04_036483 · OH-1004

Mitochondrion0.026

Rank 3 · LXL04_036483 · OH-1004

Cell membrane0.022

Rank 4 · LXL04_036483 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_036483 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06203.20CCT164-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036483	`PF06203.20`	CCT	164	205	7.7e-18	65.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SK53`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 3	41.860%	Swiss-Prot	weak database homology
`O50055`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 1	46.154%	Swiss-Prot	weak database homology
`Q9FHH8`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 5	49.020%	Swiss-Prot	weak database homology
`Q96502`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 2	50.000%	Swiss-Prot	weak database homology
`Q9FDX8`	Oryza sativa subsp. japonica	Zinc finger protein HD1	39.744%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card