LXL04_036370 | RubberDandelionOmics

Gene overview

LXL04_036370

Reference: OH-1004 Chr: Chr08 Coordinates: 40943661-40944626 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · LXL04_036370|LXL04_036370|OH1004|cDNA

ATGGAGTTTTCTTTTGATCCAAATCTTGAATTGGGACTCGGTGTTGCATCATGCCTCATCACCAGGCAAGTTTCTGAACACATTTATGaaatcaaaattataattatcGCTTGCCACAAGATGCTGAAGGAAAAACAAAATATGTTGTTCGCCCtatttttcaaaactaaagcTGGGGGATGTTGTGGAAGTAAAAGGGAAAACCATTTGGTTAAGTTACTAATTACTCTTATACCCTCAGTGAACTGTATCAGATACAC...

CDS

Download CDS FASTA

441 bp · LXL04_036370|LXL04_036370|OH1004|CDS

ATGGAGTTTTCTTTTGATCCAAATCTTGAATTGGGACTCGGTGTTGCATCATGCCTCATCACCAGGCAAGTTTCTGAACACATTTATGAAATCAAAATTATAATTATCGCTTGCCACAAGATGCTGAAGGAAAAACAAAATATGTTGTTCGCCCTATTTTTCAAAACTAAAGCTGGGGGATGTTGTGGAAGTAAAAGGGAAAACCATTTGGTTAAGTTACTAATTACTCTTATACCCTCAGTGAACTGTATCAGATACAC...

Protein

Download Protein FASTA

146 aa · LXL04_036370|LXL04_036370|OH1004|PROTEIN

MEFSFDPNLELGLGVASCLITRQVSEHIYEIKIIIIACHKMLKEKQNMLFALFFKTKAGGCCGSKRENHLVKLLITLIPSVNCIRYTPNMKKHIGMNAGGSGITPRLQVIEAIVKNPDDTTKVSLIYANVSPDDILLKKETRHACC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036370`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036370

Location Chr08:40943661-40944626 (-)

Description Similar to CBR2: NADH-cytochrome b5 reductase-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20080`	Desaturation and elongation of fatty acids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036370 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002926 tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation Biological Process

GO:0006696 ergosterol biosynthetic process Biological Process

GO:0017183 protein histidyl modification to diphthamide Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ani:ANIA_06366

ath:AT5G20080

ddi:DDB_G0285399

pgu:PGUG_05376

pno:SNOG_11449

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.391

Rank 1 · LXL04_036370 · OH-1004

Cytoplasm0.297

Rank 2 · LXL04_036370 · OH-1004

Nucleus0.182

Rank 3 · LXL04_036370 · OH-1004

Mitochondrion0.095

Rank 4 · LXL04_036370 · OH-1004

Endoplasmic reticulum0.068

Rank 5 · LXL04_036370 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00175.27NAD_binding_198-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036370	`PF00175.27`	NAD_binding_1	98	142	1.9e-10	42.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P83291`	Arabidopsis thaliana	NADH-cytochrome b5 reductase-like protein	48.630%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card