LXL04_036349 | RubberDandelionOmics

Gene overview

LXL04_036349

Reference: OH-1004 Chr: Chr08 Coordinates: 40554069-40559473 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1362 bp · LXL04_036349|LXL04_036349|OH1004|cDNA

ATGTTCACTTGCTGTGGAGGTGCCAAAGAGGACACCGATACACCTGCAAGTACTAATAATGCAGCACCACCTCGAGGACCCCCTTCTGGAAGAGTAACAGGAGGTAGTACAAGAGGAGAACCGAGGGCCAGTGGAGCAGGCAGAAGTGGGGCTCCTCATAAAACTTTACCCATTGAAGCACCAACATTGTCAATGGATGAGCTAAATAAGATGACTGGTAATTTCGGTTCGAGGGCTTTGATTGGAGAAGGTGCTTATTG...

CDS

Download CDS FASTA

1362 bp · LXL04_036349|LXL04_036349|OH1004|CDS

ATGTTCACTTGCTGTGGAGGTGCCAAAGAGGACACCGATACACCTGCAAGTACTAATAATGCAGCACCACCTCGAGGACCCCCTTCTGGAAGAGTAACAGGAGGTAGTACAAGAGGAGAACCGAGGGCCAGTGGAGCAGGCAGAAGTGGGGCTCCTCATAAAACTTTACCCATTGAAGCACCAACATTGTCAATGGATGAGCTAAATAAGATGACTGGTAATTTCGGTTCGAGGGCTTTGATTGGAGAAGGTGCTTATTG...

Protein

Download Protein FASTA

453 aa · LXL04_036349|LXL04_036349|OH1004|PROTEIN

MFTCCGGAKEDTDTPASTNNAAPPRGPPSGRVTGGSTRGEPRASGAGRSGAPHKTLPIEAPTLSMDELNKMTGNFGSRALIGEGAYCQVFHGKLSDGQEVVVKKLDASSSSELDSDFTDQLSIASRLKNEFFVELLGYCLEENNRILVYQYATMGSLHDILHGKKSVQGASPGPPLTWIQRVKIAYGAARGLEYLHEKVQPPIIHRDIRSSNILVFDEFLSKIADFNLSNPSDTAAHLHSTRVLGTFGYHAPEYAMTGQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036349`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036349

Location Chr08:40554069-40559473 (+)

Description Similar to At2g41970: Probable protein kinase At2g41970

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41970`	May phosphorylate ABA receptors and participate in ABA signaling during dehydration.	Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At2g30740`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses (By similarity).	No verified direct reference in this release
`At1g06700`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors (e.g. PYR1/RCAR11, PYL1/RCAR12, PYL3/RCAR13 and PYL2/RCAR14) to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	Catalytically inactive subgroup VIII receptor-like cytoplasmic kinases regulate the immune-triggered oxidative burst in Arabidopsis thaliana.2025 · DOI: 10.1093/jxb/erae486
`At3g59350`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors (e.g. PYL8/RCAR3, PYR1/RCAR11, PYL1/RCAR12, PYL3/RCAR13 and PYL2/RCAR14) to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036349 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:1901653 cellular response to peptide Biological Process

GO:2000037 regulation of stomatal complex patterning Biological Process

GO:2000038 regulation of stomatal complex development Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G06700

ath:AT2G30740

ath:AT2G41970

ath:AT3G59350

sly:544006

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.691

Rank 1 · LXL04_036349 · OH-1004

Cytoplasm0.239

Rank 2 · LXL04_036349 · OH-1004

Nucleus0.221

Rank 3 · LXL04_036349 · OH-1004

Endoplasmic reticulum0.044

Rank 4 · LXL04_036349 · OH-1004

Golgi apparatus0.031

Rank 5 · LXL04_036349 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase79-293 aa

PF07714.24PK_Tyr_Ser-Thr80-352 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036349	`PF00069.32`	Pkinase	79	293	1.1e-35	124.1
LXL04_036349	`PF07714.24`	PK_Tyr_Ser-Thr	80	352	1.7e-44	152.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93749`	Arabidopsis thaliana	Protein CYTOSOLIC ABA RECEPTOR KINASE 4	74.515%	Swiss-Prot	strong database homology
`O49339`	Arabidopsis thaliana	Protein CYTOSOLIC ABA RECEPTOR KINASE 8	62.921%	Swiss-Prot	strong database homology
`Q8H1G6`	Arabidopsis thaliana	Protein CYTOSOLIC ABA RECEPTOR KINASE 7	71.711%	Swiss-Prot	moderate database homology
`B9DFG5`	Arabidopsis thaliana	Protein CYTOSOLIC ABA RECEPTOR KINASE 5	64.345%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card