LXL04_036326 | RubberDandelionOmics

Gene overview

LXL04_036326

Reference: OH-1004 Chr: Chr08 Coordinates: 40105679-40106472 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

612 bp · LXL04_036326|LXL04_036326|OH1004|cDNA

ATGGGTTGGGCTAATGAGGTAGCAAGATCTTTCAGAACTCTTAATTACACATTCACAACCTCCGGTGCGTACGGCACAGCCGGAAATTGTTCCTTTTCCATGAATCTCCCTCACCGGAACATTGCCGATGGTGGAATCCACGAAGAGTTTTCGTTGCCGGGGTTCCCAGAATCTCTTCAGTGTTTGATCACGCATCTTCATCCGTATTATAGAGATTTTGATGGTAAAGATGAATGGTCAACATTTTTCCTACCTCAACT...

CDS

Download CDS FASTA

612 bp · LXL04_036326|LXL04_036326|OH1004|CDS

ATGGGTTGGGCTAATGAGGTAGCAAGATCTTTCAGAACTCTTAATTACACATTCACAACCTCCGGTGCGTACGGCACAGCCGGAAATTGTTCCTTTTCCATGAATCTCCCTCACCGGAACATTGCCGATGGTGGAATCCACGAAGAGTTTTCGTTGCCGGGGTTCCCAGAATCTCTTCAGTGTTTGATCACGCATCTTCATCCGTATTATAGAGATTTTGATGGTAAAGATGAATGGTCAACATTTTTCCTACCTCAACT...

Protein

Download Protein FASTA

203 aa · LXL04_036326|LXL04_036326|OH1004|PROTEIN

MGWANEVARSFRTLNYTFTTSGAYGTAGNCSFSMNLPHRNIADGGIHEEFSLPGFPESLQCLITHLHPYYRDFDGKDEWSTFFLPQLSYSLQSNGWLCNTVEEMETIGCEALRNLIKLPLWCIGPLLPSDMLKTNLVIESLSQGVPMIGCPLGAEQGFNAKMLVEKGVCVVLTTRGENRIVKEDVKKVIEVVFDRNDMRKKAT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036326`
TK1151 ID	TkA04G054780
OH-1004 ID	LXL04_036326
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 73.143 / OH-1004 63.054 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036326

Location Chr08:40105679-40106472 (-)

Description Similar to GLT3: Crocetin glucosyltransferase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g12890`	UDP-glycosyltransferase 92A1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036326 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G12890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.625

Rank 1 · LXL04_036326 · OH-1004

Peroxisome0.162

Rank 2 · LXL04_036326 · OH-1004

Nucleus0.131

Rank 3 · LXL04_036326 · OH-1004

Endoplasmic reticulum0.071

Rank 4 · LXL04_036326 · OH-1004

Mitochondrion0.052

Rank 5 · LXL04_036326 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT135-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036326	`PF00201.25`	UDPGT	135	195	1.2e-06	28.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXV0`	Arabidopsis thaliana	UDP-glycosyltransferase 92A1	31.008%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card