LXL04_036166 | RubberDandelionOmics

Gene overview

LXL04_036166

Reference: OH-1004 Chr: Chr08 Coordinates: 37405693-37408731 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1575 bp · LXL04_036166|LXL04_036166|OH1004|cDNA

ATGGCGGAGGGTTTCGAATTGTACCATATCCCACAACAAAGCAGACGCGATAAGCTCAGAGTGGTCATCCAAAACGATCACACCAGTGATTGCGTTGAGGATCTGCGAGGGTGCGCAGGTTTAGGTCTACTCCCTTTGTATGATCAATCCTCGTTTATCTCTTCTTCCCAGAATCTGTTATCCTGCGGTAATATTAAATCCTCATTAATGGCTGATGATGGTAATGCTAGTGATTATAGGACGGCGAGAGCTGTTATAGA...

CDS

Download CDS FASTA

1575 bp · LXL04_036166|LXL04_036166|OH1004|CDS

ATGGCGGAGGGTTTCGAATTGTACCATATCCCACAACAAAGCAGACGCGATAAGCTCAGAGTGGTCATCCAAAACGATCACACCAGTGATTGCGTTGAGGATCTGCGAGGGTGCGCAGGTTTAGGTCTACTCCCTTTGTATGATCAATCCTCGTTTATCTCTTCTTCCCAGAATCTGTTATCCTGCGGTAATATTAAATCCTCATTAATGGCTGATGATGGTAATGCTAGTGATTATAGGACGGCGAGAGCTGTTATAGA...

Protein

Download Protein FASTA

524 aa · LXL04_036166|LXL04_036166|OH1004|PROTEIN

MAEGFELYHIPQQSRRDKLRVVIQNDHTSDCVEDLRGCAGLGLLPLYDQSSFISSSQNLLSCGNIKSSLMADDGNASDYRTARAVIDTSSHESSDLPSGNDHCNFVYRHQDVRFIEQHEQGRFHGGDFVALSLSSQNTQNGTPPVELNLRSYGGGDYGRSAVVTNGPYTGYASILKGSKFLKPAQQMLDEICDVGFGIFAEKVHVDCGLMTDPPSLMENLRTSVADSDCGGVDKRKRSTLISLLDEVYKRYKQYYQQIQT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036166`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036166

Location Chr08:37405693-37408731 (+)

Description Similar to BLH9: BEL1-like homeodomain protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02030`	Transcription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation.	No verified direct reference in this release
`At2g27990`	Required for specifying floral primordia and establishing early internode patterning events during inflorescence development.	No verified direct reference in this release
`At1g75410`	Transcription factor involved in the nuclear import of SHOOT MERISTEMLESS (STM).	No verified direct reference in this release
`At4g34610`	BEL1-like homeodomain protein 6.	No verified direct reference in this release
`At2g27220`	BEL1-like homeodomain protein 5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036166 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007389 pattern specification process Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010076 maintenance of floral meristem identity Biological Process

GO:0010077 maintenance of inflorescence meristem identity Biological Process

GO:0010089 xylem development Biological Process

GO:0010154 fruit development Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010229 inflorescence development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G75410

ath:AT2G27220

ath:AT2G27990

ath:AT4G34610

ath:AT5G02030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.954

Rank 1 · LXL04_036166 · OH-1004

Cytoplasm0.109

Rank 2 · LXL04_036166 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_036166 · OH-1004

Endoplasmic reticulum0.016

Rank 4 · LXL04_036166 · OH-1004

Plastid0.014

Rank 5 · LXL04_036166 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07526.17POX174-297 aa

PF05920.18Homeobox_KN349-388 aa

PF00046.36Homeodomain356-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036166	`PF07526.17`	POX	174	297	4e-30	105.8
LXL04_036166	`PF05920.18`	Homeobox_KN	349	388	6.3e-20	71.5
LXL04_036166	`PF00046.36`	Homeodomain	356	388	1.5e-07	31.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZM8`	Arabidopsis thaliana	BEL1-like homeodomain protein 9	45.952%	Swiss-Prot	moderate database homology
`Q9SJJ3`	Arabidopsis thaliana	BEL1-like homeodomain protein 8	45.724%	Swiss-Prot	moderate database homology
`Q9FWS9`	Arabidopsis thaliana	BEL1-like homeodomain protein 3	38.028%	Swiss-Prot	weak database homology
`O65685`	Arabidopsis thaliana	BEL1-like homeodomain protein 6	38.344%	Swiss-Prot	moderate database homology
`Q8S897`	Arabidopsis thaliana	BEL1-like homeodomain protein 5	40.942%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card