LXL04_036136 | RubberDandelionOmics

Gene overview

LXL04_036136

Reference: OH-1004 Chr: Chr08 Coordinates: 36350682-36352632 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

948 bp · LXL04_036136|LXL04_036136|OH1004|cDNA

ATGGCATTGCTCTTACACGATCAAACAATGTCGCTTTACATCGGTCGCGAGACTTCCAAGCTGTGGAAAAGAATTAGTGCAGAAACTATAACTGAAGTCAACCTTCTAGCGGAGAACTGGAAGTATATTCTCGGCGGTTTAACTTGCCAGTACATTCATGGGCTGGCTGCTCGAGGTGTTCACTACATTCATCGCCCTGGTCCAATTCTACAAGACACTGGATTCCGTCTACTTCCAGAGCTTGGACAGGAGAGAGCGTA...

CDS

Download CDS FASTA

948 bp · LXL04_036136|LXL04_036136|OH1004|CDS

ATGGCATTGCTCTTACACGATCAAACAATGTCGCTTTACATCGGTCGCGAGACTTCCAAGCTGTGGAAAAGAATTAGTGCAGAAACTATAACTGAAGTCAACCTTCTAGCGGAGAACTGGAAGTATATTCTCGGCGGTTTAACTTGCCAGTACATTCATGGGCTGGCTGCTCGAGGTGTTCACTACATTCATCGCCCTGGTCCAATTCTACAAGACACTGGATTCCGTCTACTTCCAGAGCTTGGACAGGAGAGAGCGTA...

Protein

Download Protein FASTA

315 aa · LXL04_036136|LXL04_036136|OH1004|PROTEIN

MALLLHDQTMSLYIGRETSKLWKRISAETITEVNLLAENWKYILGGLTCQYIHGLAARGVHYIHRPGPILQDTGFRLLPELGQERAYVSETVFTFVFLSFVLWSLHPFILKTKKIYTILIWCRVLAFLSACQFLRILTFYSTQLPGPNYHCREGSRFATLPRPDNPLEFLLIMPRGVLYGCGDLIFSSHMIFSLVFVRTYQKYGTRRFIKQCAWLTVVIQSLLIIASRKHYTVDVVVAWYTVNLVVFFLDRKLAEMPERN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036136`
TK1151 ID	TkA04G072550
OH-1004 ID	LXL04_036136
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036136

Location Chr08:36350682-36352632 (+)

Description Similar to IPCS2: Phosphatidylinositol:ceramide inositolphosphotransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37940`	Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis.	An inositolphosphorylceramide synthase is involved in regulation of plant programmed cell death associated with defense in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060053
`At3g54020`	Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis.	No verified direct reference in this release
`At2g29525`	Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0850100`	Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis.	No verified direct reference in this release
`UniProt: B8ACH9`	Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036136 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0030148 sphingolipid biosynthetic process Biological Process

GO:0046513 ceramide biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0033188 sphingomyelin synthase activity Molecular Function

GO:0045140 inositol phosphoceramide synthase activity Molecular Function

GO:0047493 ceramide cholinephosphotransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G29525

ath:AT2G37940

ath:AT3G54020

dosa:Os01g0850100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.473

Rank 1 · LXL04_036136 · OH-1004

Golgi apparatus0.342

Rank 2 · LXL04_036136 · OH-1004

Cytoplasm0.095

Rank 3 · LXL04_036136 · OH-1004

Cell membrane0.078

Rank 4 · LXL04_036136 · OH-1004

Nucleus0.078

Rank 5 · LXL04_036136 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14360.13PAP2_C180-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036136	`PF14360.13`	PAP2_C	180	248	4.5e-23	82.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SH93`	Arabidopsis thaliana	Phosphatidylinositol:ceramide inositolphosphotransferase 2	73.026%	Swiss-Prot	strong database homology
`Q9M325`	Arabidopsis thaliana	Phosphatidylinositol:ceramide inositolphosphotransferase 1	70.227%	Swiss-Prot	strong database homology
`Q56Y01`	Arabidopsis thaliana	Phosphatidylinositol:ceramide inositolphosphotransferase 3	64.664%	Swiss-Prot	strong database homology
`Q5N7A7`	Oryza sativa subsp. japonica	Phosphatidylinositol:ceramide inositolphosphotransferase	65.094%	Swiss-Prot	strong database homology
`B8ACH9`	Oryza sativa subsp. indica	Phosphatidylinositol:ceramide inositolphosphotransferase	65.094%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card