LXL04_036114 | RubberDandelionOmics

Gene overview

LXL04_036114

Reference: OH-1004 Chr: Chr08 Coordinates: 35933044-35936835 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1788 bp · LXL04_036114|LXL04_036114|OH1004|cDNA

ATGGAAATCGAGTCACCTTCTTCAACTGCGAAGAGTCATTTCAAGCTATGGAGCGAACTAGAGTTGCACGAATTTCCAGATAAATTCGTTATCAGACCAGTTAAATTTCCGGATCAAGGCTTCTCTATCACTCGTTCCGATGGAAGCTTTCGTAAACTGGACGGTGAAGTTAATCTGGAAACTGCTTCCAGGATCTATACCATATTTGGAGTTGCTGGAACAATTAGGTTGCTTGCAGGGACATTTGTATTGGTCATAAC...

CDS

Download CDS FASTA

1788 bp · LXL04_036114|LXL04_036114|OH1004|CDS

ATGGAAATCGAGTCACCTTCTTCAACTGCGAAGAGTCATTTCAAGCTATGGAGCGAACTAGAGTTGCACGAATTTCCAGATAAATTCGTTATCAGACCAGTTAAATTTCCGGATCAAGGCTTCTCTATCACTCGTTCCGATGGAAGCTTTCGTAAACTGGACGGTGAAGTTAATCTGGAAACTGCTTCCAGGATCTATACCATATTTGGAGTTGCTGGAACAATTAGGTTGCTTGCAGGGACATTTGTATTGGTCATAAC...

Protein

Download Protein FASTA

595 aa · LXL04_036114|LXL04_036114|OH1004|PROTEIN

MEIESPSSTAKSHFKLWSELELHEFPDKFVIRPVKFPDQGFSITRSDGSFRKLDGEVNLETASRIYTIFGVAGTIRLLAGTFVLVITSRKEVGTYLGYPVFRVMSMKFLSCNEGLRNLTNQQKKDEAYFQTLLRVVEETPGLYYSYETDITLNLQRRYKMADGWISKPIWKQADPRFVWNRNILEELIENKVDEFIVSLLQVRFQTGQLKLNNMISTVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQLLEYNGFK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036114`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036114

Location Chr08:35933044-35936835 (+)

Description Similar to SAC8: Phosphoinositide phosphatase SAC8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51830`	May act as a phosphoinositide phosphatase that hydrolyzes PtdIns(3)P and PtdIns(4)P.	Three SAC1-like genes show overlapping patterns of expression in Arabidopsis but are remarkably silent during embryo development.2003 · DOI: 10.1046/j.1365-313x.2003.01720.x
`At3g51460`	May act as a phosphoinositide phosphatase that preferentially hydrolyzes PtdIns(4)P.	Three SAC1-like genes show overlapping patterns of expression in Arabidopsis but are remarkably silent during embryo development.2003 · DOI: 10.1046/j.1365-313x.2003.01720.x Root hair defective4 encodes a phosphatidylinositol-4-phosphate phosphatase required for proper root hair development in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.107.054304
`At5g66020`	May act as a phosphoinositide phosphatase that hydrolyzes PtdIns(3)P and PtdIns(4)P.	Three SAC1-like genes show overlapping patterns of expression in Arabidopsis but are remarkably silent during embryo development.2003 · DOI: 10.1046/j.1365-313x.2003.01720.x Dissecting the beta-aminobutyric acid-induced priming phenomenon in Arabidopsis.2005 · DOI: 10.1105/tpc.104.029728

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036114 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G51460

ath:AT3G51830

ath:AT5G66020

dre:558940

xla:444578

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.404

Rank 1 · LXL04_036114 · OH-1004

Cytoplasm0.284

Rank 2 · LXL04_036114 · OH-1004

Golgi apparatus0.155

Rank 3 · LXL04_036114 · OH-1004

Nucleus0.131

Rank 4 · LXL04_036114 · OH-1004

Mitochondrion0.110

Rank 5 · LXL04_036114 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02383.24Syja_N69-352 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036114	`PF02383.24`	Syja_N	69	352	5.8e-74	249.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96328`	Arabidopsis thaliana	Phosphoinositide phosphatase SAC8	63.423%	Swiss-Prot	strong database homology
`Q9C5G5`	Arabidopsis thaliana	Phosphoinositide phosphatase SAC7	45.868%	Swiss-Prot	moderate database homology
`Q7X911`	Arabidopsis thaliana	Phosphoinositide phosphatase SAC6	44.143%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card