LXL04_036088 | RubberDandelionOmics

Gene overview

LXL04_036088

Reference: OH-1004 Chr: Chr08 Coordinates: 35506823-35509834 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

879 bp · LXL04_036088|LXL04_036088|OH1004|cDNA

ATGTTTCCTAAAATATTTGAAACAATCGTTAGTCTACCACCCAAGGAGAAGGGTGTATATGTTACGTTGTGGTGGGATGACGCAGCTTATCAGAAGATCTTTATTGAGCCGTTGCGACAAAATCGGGAACAAGTCAACCGGCTTGTCCGGTCACTATTAGTAAAAGTCTTTCATTCTCCCGGTTTTCTGCCCCTTACTCGCACTTCTGCTCTCTTCCACTTCACCGATCACAGATCGTTTCTAACTTCTCGCTCTAGAGA...

CDS

Download CDS FASTA

879 bp · LXL04_036088|LXL04_036088|OH1004|CDS

ATGTTTCCTAAAATATTTGAAACAATCGTTAGTCTACCACCCAAGGAGAAGGGTGTATATGTTACGTTGTGGTGGGATGACGCAGCTTATCAGAAGATCTTTATTGAGCCGTTGCGACAAAATCGGGAACAAGTCAACCGGCTTGTCCGGTCACTATTAGTAAAAGTCTTTCATTCTCCCGGTTTTCTGCCCCTTACTCGCACTTCTGCTCTCTTCCACTTCACCGATCACAGATCGTTTCTAACTTCTCGCTCTAGAGA...

Protein

Download Protein FASTA

292 aa · LXL04_036088|LXL04_036088|OH1004|PROTEIN

MFPKIFETIVSLPPKEKGVYVTLWWDDAAYQKIFIEPLRQNREQVNRLVRSLLVKVFHSPGFLPLTRTSALFHFTDHRSFLTSRSRERLIPSLSFSALTYAYSFFNLLWNNITKVHNFNLVMLHVHQIKSFTGAKGKGAAKRDSLKPVDDKKVGKRKAAPAKAVGKGKAKAVKDPNKPKRPPSAFFVFLEEFRKTFKKENPDVKAVSAVGKAGGEKWKSLTADEKAPYEAKAAKRKTEYEKVMTAYNKKLEMGDDDEESE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036088`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036088

Location Chr08:35506823-35509834 (-)

Description Similar to HMGB1: High mobility group B protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51880`	Binds preferentially double-stranded DNA.	No verified direct reference in this release
`At1g20693`	Binds preferentially double-stranded DNA.	No verified direct reference in this release
`At1g20696`	Binds preferentially double-stranded DNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036088 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

KEGG gene cross-reference

ath:AT1G20693

ath:AT1G20696

ath:AT3G51880

ini:109177607

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.734

Rank 1 · LXL04_036088 · OH-1004

Cytoplasm0.272

Rank 2 · LXL04_036088 · OH-1004

Endoplasmic reticulum0.048

Rank 3 · LXL04_036088 · OH-1004

Mitochondrion0.042

Rank 4 · LXL04_036088 · OH-1004

Cell membrane0.042

Rank 5 · LXL04_036088 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09011.17HMG_box_2175-247 aa

PF00505.26HMG_box178-247 aa

PF24815.2HMG_WDHD1181-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036088	`PF09011.17`	HMG_box_2	175	247	5.8e-15	56.4
LXL04_036088	`PF00505.26`	HMG_box	178	247	1.3e-23	83.9
LXL04_036088	`PF24815.2`	HMG_WDHD1	181	231	2.1e-13	50.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49595`	Arabidopsis thaliana	High mobility group B protein 1	67.123%	Swiss-Prot	weak database homology
`O49596`	Arabidopsis thaliana	High mobility group B protein 2	70.642%	Swiss-Prot	weak database homology
`P93047`	Arabidopsis thaliana	High mobility group B protein 3	70.192%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card