LXL04_036082 | RubberDandelionOmics

Gene overview

LXL04_036082

Reference: OH-1004 Chr: Chr08 Coordinates: 35438436-35441116 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1593 bp · LXL04_036082|LXL04_036082|OH1004|cDNA

ATGATTTCTGGATGCGGCTGCGTAACTAACAAATCCCCGTTGCTGTTCCAGACATCTCTAGCAGGTTCATTTCCATCTTCAATATGGAACACAAAAATCAGGTTAAATACCACAAAAAAGACTCCATTTTTTCCTTGCATAAAGTGTTCAAAATCAGATGACGATAACGAAATCGACAAACCATCTTTCGAGAAACTATCCGTCGAGCGGGCCCCATACCACAGTTACAAAGACTCAATATCCGGGCAGGTGGAGCCCGC...

CDS

Download CDS FASTA

1593 bp · LXL04_036082|LXL04_036082|OH1004|CDS

ATGATTTCTGGATGCGGCTGCGTAACTAACAAATCCCCGTTGCTGTTCCAGACATCTCTAGCAGGTTCATTTCCATCTTCAATATGGAACACAAAAATCAGGTTAAATACCACAAAAAAGACTCCATTTTTTCCTTGCATAAAGTGTTCAAAATCAGATGACGATAACGAAATCGACAAACCATCTTTCGAGAAACTATCCGTCGAGCGGGCCCCATACCACAGTTACAAAGACTCAATATCCGGGCAGGTGGAGCCCGC...

Protein

Download Protein FASTA

530 aa · LXL04_036082|LXL04_036082|OH1004|PROTEIN

MISGCGCVTNKSPLLFQTSLAGSFPSSIWNTKIRLNTTKKTPFFPCIKCSKSDDDNEIDKPSFEKLSVERAPYHSYKDSISGQVEPASGARSSILGQDYLPEGTVGQARAAGARGPDDDSFATPSFGQNPGSKRKMKMYKSSSSTPSSNSTQTTNTVVDQEEGLIGLEDEDEGLNEKFEESKDEFSDFVVYQKESEMEELSGYELDKKIGNPHPFIDPKKRREIKEPLTSEELWWNWRKPDKQQWSRWQKKRPDAETVFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036082`
TK1151 ID	TkA04G077180
OH-1004 ID	LXL04_036082
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036082

Location Chr08:35438436-35441116 (+)

Description Similar to PTAC12: Protein PLASTID TRANSCRIPTIONALLY ACTIVE 12, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34640`	Involved in plastid gene expression.	Arabidopsis HEMERA/pTAC12 initiates photomorphogenesis by phytochromes.2010 · DOI: 10.1016/j.cell.2010.05.007

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0769900`	Required for the activity of the plastid-encoded RNA polymerase (PEP) and full expression of genes transcribed by PEP.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036082 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009411 response to UV Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009637 response to blue light Biological Process

GO:0009650 UV protection Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0010114 response to red light Biological Process

GO:0010218 response to far red light Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0030163 protein catabolic process Biological Process

KEGG gene cross-reference

ath:AT2G34640

dosa:Os01g0769900

osa:4325601

zma:100275546

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.887

Rank 1 · LXL04_036082 · OH-1004

Nucleus0.080

Rank 2 · LXL04_036082 · OH-1004

Mitochondrion0.061

Rank 3 · LXL04_036082 · OH-1004

Cytoplasm0.029

Rank 4 · LXL04_036082 · OH-1004

Cell membrane0.017

Rank 5 · LXL04_036082 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28667.1PTAC1215-530 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036082	`PF28667.1`	PTAC12	15	530	4e-222	739.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IHY7`	Arabidopsis thaliana	Protein PLASTID TRANSCRIPTIONALLY ACTIVE 12, chloroplastic	57.786%	Swiss-Prot	strong database homology
`Q0JIZ1`	Oryza sativa subsp. japonica	Protein PLASTID TRANSCRIPTIONALLY ACTIVE 12, chloroplastic	52.362%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card