LXL04_036070 | RubberDandelionOmics

Gene overview

LXL04_036070

Reference: OH-1004 Chr: Chr08 Coordinates: 35046817-35050028 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1536 bp · LXL04_036070|LXL04_036070|OH1004|cDNA

ATGTCAACCTATTCGCTCTCTTTTAACCCCTCTCTCACTGTTCCATCCTCCTCTGCGTCTTCTTGCTCATCATCTTCTTCCATAGGTACTACTTCTAGAATTTCATGTTTCAATGCTTTTGAAACGAAACCCATCTGCTTTACCCCCTTCAAGAATCGGTCTTTTCATTGTAAACGAAGAACAAGAACACCGATTATAGTTTCTTCAGCTGATAAAAGTACAATTGAAGAATTGAGAAAAGATGACGAAGAAGGCCCCCC...

CDS

Download CDS FASTA

1536 bp · LXL04_036070|LXL04_036070|OH1004|CDS

ATGTCAACCTATTCGCTCTCTTTTAACCCCTCTCTCACTGTTCCATCCTCCTCTGCGTCTTCTTGCTCATCATCTTCTTCCATAGGTACTACTTCTAGAATTTCATGTTTCAATGCTTTTGAAACGAAACCCATCTGCTTTACCCCCTTCAAGAATCGGTCTTTTCATTGTAAACGAAGAACAAGAACACCGATTATAGTTTCTTCAGCTGATAAAAGTACAATTGAAGAATTGAGAAAAGATGACGAAGAAGGCCCCCC...

Protein

Download Protein FASTA

511 aa · LXL04_036070|LXL04_036070|OH1004|PROTEIN

MSTYSLSFNPSLTVPSSSASSCSSSSSIGTTSRISCFNAFETKPICFTPFKNRSFHCKRRTRTPIIVSSADKSTIEELRKDDEEGPPSQVESEISTKPRRIALFVEPSPFAYVSGYKNRFQNFIRYLREMGDEVMVVTTHEGVPQEFYGAKIVGSKSFPCPWYQNVPLSLALSPRIINEVKQFKPDIIHASSPGIMVFGALAIAKMLCVPIVMSYHTHVPVYIPRYTFSWLVKPMWLIIKFLHRAADLTLVPSAAIAKDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036070`
TK1151 ID	TkA04G080280
OH-1004 ID	LXL04_036070
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036070

Location Chr08:35046817-35050028 (-)

Description Similar to SQD2: Sulfoquinovosyl transferase SQD2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01220`	Catalyzes the transfer of the sulfoquinovose moiety from UDP-sulfoquinovose to diacylglycerol during sulfolipid biosynthesis.	Arabidopsis disrupted in SQD2 encoding sulfolipid synthase is impaired in phosphate-limited growth.2002 · DOI: 10.1073/pnas.082696499

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036070 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009247 glycolipid biosynthetic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0046488 phosphatidylinositol metabolic process Biological Process

GO:0046506 sulfolipid biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0000030 mannosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G01220

cgb:cg0554

cgl:Cgl0469

msb:LJ00_05530

msg:MSMEI_1080

msm:MSMEG_1113

mtc:MT0583

mtu:Rv0557

mtv:RVBD_0557

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.962

Rank 1 · LXL04_036070 · OH-1004

Mitochondrion0.039

Rank 2 · LXL04_036070 · OH-1004

Nucleus0.020

Rank 3 · LXL04_036070 · OH-1004

Cytoplasm0.018

Rank 4 · LXL04_036070 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_036070 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13439.13Glyco_transf_4115-281 aa

PF13579.13Glyco_trans_4_4115-271 aa

PF00534.27Glycos_transf_1302-452 aa

PF13692.13Glyco_trans_1_4303-440 aa

PF13524.13Glyco_trans_1_2320-456 aa

PF20706.4GT4-conflict363-464 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036070	`PF13439.13`	Glyco_transf_4	115	281	9.6e-31	107.8
LXL04_036070	`PF13579.13`	Glyco_trans_4_4	115	271	2e-16	61.4
LXL04_036070	`PF00534.27`	Glycos_transf_1	302	452	5.9e-27	95.0
LXL04_036070	`PF13692.13`	Glyco_trans_1_4	303	440	3.2e-28	99.5
LXL04_036070	`PF13524.13`	Glyco_trans_1_2	320	456	4e-07	30.8
LXL04_036070	`PF20706.4`	GT4-conflict	363	464	5.3e-07	29.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S4F6`	Arabidopsis thaliana	Sulfoquinovosyl transferase SQD2	76.552%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card