LXL04_036054 | RubberDandelionOmics

Gene overview

LXL04_036054

Reference: OH-1004 Chr: Chr08 Coordinates: 34762596-34765718 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3123 bp · LXL04_036054|LXL04_036054|OH1004|cDNA

ATGATAACCCAGTTCTTCTTTCAGATTTTGTTGATCAGCTTTTACCTGATCATGTTTGGGGTTAATTCTATATTGGTTTCTGACCAATGTCAAACTGGCCATCAAACAATTTTGATCAAGTTAAAGAGAGAATTACAGTTCAACTCTTCAACAAAATTAGTGTCTTGGAACCCAAATGCCTCACATTGTTGCACCTGGGTAGGTGTTGAATGCGGCATCGGAGGTGAGGTTATTGGTCTAGATTTAAGCAATGAAAGTAT...

CDS

Download CDS FASTA

3123 bp · LXL04_036054|LXL04_036054|OH1004|CDS

ATGATAACCCAGTTCTTCTTTCAGATTTTGTTGATCAGCTTTTACCTGATCATGTTTGGGGTTAATTCTATATTGGTTTCTGACCAATGTCAAACTGGCCATCAAACAATTTTGATCAAGTTAAAGAGAGAATTACAGTTCAACTCTTCAACAAAATTAGTGTCTTGGAACCCAAATGCCTCACATTGTTGCACCTGGGTAGGTGTTGAATGCGGCATCGGAGGTGAGGTTATTGGTCTAGATTTAAGCAATGAAAGTAT...

Protein

Download Protein FASTA

1040 aa · LXL04_036054|LXL04_036054|OH1004|PROTEIN

MITQFFFQILLISFYLIMFGVNSILVSDQCQTGHQTILIKLKRELQFNSSTKLVSWNPNASHCCTWVGVECGIGGEVIGLDLSNESIYGGIDGFSALFGIETLQVLNLARNNFHFTQIPSGFGNITSLKNLNLSNSGFSGQIPGELSQLTNLEVLDLSSLFSLGTRSLKLEKPNLSMLVQNLTRLKSLYLDNVNMSAQKSDWCRALSSFLPDLEALSLSNCQLSGPFDHSLKKLKSLSVIRFAQNNLNASVPIFFGKFRN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036054`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036054

Location Chr08:34762596-34765718 (-)

Description Similar to RLP6: Receptor-like protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g45616`	Receptor-like protein 6.	No verified direct reference in this release
`At1g47890`	Receptor-like protein 7.	No verified direct reference in this release
`At3g11010`	Receptor-like protein 34.	No verified direct reference in this release
`At3g05660`	Receptor-like protein 33.	No verified direct reference in this release
`At3g11080`	Receptor-like protein 35.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036054 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G45616

ath:AT1G47890

ath:AT3G05660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.862

Rank 1 · LXL04_036054 · OH-1004

Endoplasmic reticulum0.090

Rank 2 · LXL04_036054 · OH-1004

Cytoplasm0.058

Rank 3 · LXL04_036054 · OH-1004

Nucleus0.047

Rank 4 · LXL04_036054 · OH-1004

Lysosome / Vacuole0.023

Rank 5 · LXL04_036054 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_237-71 aa

PF13855.13LRR_8102-159 aa

PF13855.13LRR_8212-271 aa

PF25013.1LRR_Zer-1279-370 aa

PF13855.13LRR_8307-367 aa

PF12799.14LRR_4356-395 aa

PF13855.13LRR_8379-439 aa

PF13855.13LRR_8670-730 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036054	`PF08263.18`	LRRNT_2	37	71	3.8e-08	34.2
LXL04_036054	`PF13855.13`	LRR_8	102	159	5.7e-51	170.8
LXL04_036054	`PF13855.13`	LRR_8	212	271	5.7e-51	170.8
LXL04_036054	`PF25013.1`	LRR_Zer-1	279	370	1.6e-14	54.9
LXL04_036054	`PF13855.13`	LRR_8	307	367	5.7e-51	170.8
LXL04_036054	`PF12799.14`	LRR_4	356	395	6.5e-43	144.5
LXL04_036054	`PF13855.13`	LRR_8	379	439	5.7e-51	170.8
LXL04_036054	`PF13855.13`	LRR_8	670	730	5.7e-51	170.8
LXL04_036054	`PF13855.13`	LRR_8	719	778	5.7e-51	170.8
LXL04_036054	`PF13855.13`	LRR_8	890	949	5.7e-51	170.8
LXL04_036054	`PF12799.14`	LRR_4	893	926	6.5e-43	144.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C637`	Arabidopsis thaliana	Receptor-like protein 6	36.229%	Swiss-Prot	moderate database homology
`Q9C699`	Arabidopsis thaliana	Receptor-like protein 7	36.464%	Swiss-Prot	moderate database homology
`Q9SRL2`	Arabidopsis thaliana	Receptor-like protein 34	33.752%	Swiss-Prot	moderate database homology
`F4J8G2`	Arabidopsis thaliana	Receptor-like protein 33	36.808%	Swiss-Prot	moderate database homology
`Q9SRL7`	Arabidopsis thaliana	Receptor-like protein 35	37.284%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card