Gene Card
Gene overview
cDNA / CDS / Protein Sequences
453 bp · LXL04_036029|LXL04_036029|OH1004|cDNA
ATGATTTTCTTCACACCCGCTACTTCCTTCACCGATCTCGATTCCGACCACCTCAGCCCTCCGCCACCACCTGCGTCCACCGCCTGCACTCGACGAGCACGACCGCTGTTGTTTCTCAATCAACAGGTCGCATCGGCATGCCGATTTCTCCATCGACGCGATTGCCGACTGTTTCTCCATCGACGACCGTCTGTTTCTCCATCGACGACCACGACGACGACCGCGGGTGTTTCTCCATCGAAGACCGTCCCGATTTCTCC...
453 bp · LXL04_036029|LXL04_036029|OH1004|CDS
ATGATTTTCTTCACACCCGCTACTTCCTTCACCGATCTCGATTCCGACCACCTCAGCCCTCCGCCACCACCTGCGTCCACCGCCTGCACTCGACGAGCACGACCGCTGTTGTTTCTCAATCAACAGGTCGCATCGGCATGCCGATTTCTCCATCGACGCGATTGCCGACTGTTTCTCCATCGACGACCGTCTGTTTCTCCATCGACGACCACGACGACGACCGCGGGTGTTTCTCCATCGAAGACCGTCCCGATTTCTCC...
Protein
Download Protein FASTA150 aa · LXL04_036029|LXL04_036029|OH1004|PROTEIN
MIFFTPATSFTDLDSDHLSPPPPPASTACTRRARPLLFLNQQVASACRFLHRRDCRLFLHRRPSVSPSTTTTTTAGVSPSKTVPISPPSILPILAVSSGNFSLSPAIAAIVVRFSEVLRTAVSNRLAKVQGFLFRAAFLRCVPTFVQLII
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036029 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036029 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr08:34375977-34377123 (+) | ||||||
| Description | Similar to ABCD1: ABC transporter D family member 1 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0006635 fatty acid beta-oxidation Biological Process GO:0006744 ubiquinone biosynthetic process Biological Process GO:0007031 peroxisome organization Biological Process GO:0010030 positive regulation of seed germination Biological Process GO:0015910 long-chain fatty acid import into peroxisome Biological Process GO:0015916 fatty-acyl-CoA transport Biological Process GO:0016042 lipid catabolic process Biological Process GO:0042760 very long-chain fatty acid catabolic process Biological Process GO:0005777 peroxisome Cellular Component GO:0005778 peroxisomal membrane Cellular Component GO:0046861 glyoxysomal membrane Cellular Component GO:0005324 long-chain fatty acid transmembrane transporter activity Molecular Function | ||||||
| KEGG gene cross-reference | ath:AT4G39850 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q94FB9 | Arabidopsis thaliana | ABC transporter D family member 1 | 78.788% | Swiss-Prot | weak database homology |