LXL04_035943 | RubberDandelionOmics

Gene overview

LXL04_035943

Reference: OH-1004 Chr: Chr08 Coordinates: 32556867-32558587 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1509 bp · LXL04_035943|LXL04_035943|OH1004|cDNA

ATGGCTTCTACTACCATGCTTTCTTCAACCACCCTCAAACTCTACTCCAATTTCATTTGCTTCTCCCCTTCTAAACCCACATTACCAAACAATATCATCCCAATCACAACTAATTTCAGGAGAAACCCATTAAAACTCAACGCATCTTTCAATGAAATCTCCGATGAGATATTAGAAACCACGCTTCATTTAGACCAGTTCCCGATTTTCAAATCGGGGTATGCGCAGTTCCAGAGAGTCACGGAAGATGTACCGGAGCC...

CDS

Download CDS FASTA

1509 bp · LXL04_035943|LXL04_035943|OH1004|CDS

ATGGCTTCTACTACCATGCTTTCTTCAACCACCCTCAAACTCTACTCCAATTTCATTTGCTTCTCCCCTTCTAAACCCACATTACCAAACAATATCATCCCAATCACAACTAATTTCAGGAGAAACCCATTAAAACTCAACGCATCTTTCAATGAAATCTCCGATGAGATATTAGAAACCACGCTTCATTTAGACCAGTTCCCGATTTTCAAATCGGGGTATGCGCAGTTCCAGAGAGTCACGGAAGATGTACCGGAGCC...

Protein

Download Protein FASTA

502 aa · LXL04_035943|LXL04_035943|OH1004|PROTEIN

MASTTMLSSTTLKLYSNFICFSPSKPTLPNNIIPITTNFRRNPLKLNASFNEISDEILETTLHLDQFPIFKSGYAQFQRVTEDVPEPEKWGVLVFAGLVWIYLTARPGVLFGAIDSYILAPAQKVFDGLSGRRNLKRSDFLIGDKLGEGSFGVVFSGVVVPKNFTVEERIRKSGSRRRELEKDERFKEKVILKQVKIGVAGAIECGEFEEWFNYRLSRAAPETCAEFLGSFVSDKTTSQFTKGEKWLVWKFEGDRDLADY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035943`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035943

Location Chr08:32556867-32558587 (-)

Description Similar to STN8: Serine/threonine-protein kinase STN8, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01920`	May phosphorylate proteins of the photosystem II core complex.	STN8 protein kinase in Arabidopsis thaliana is specific in phosphorylation of photosystem II core proteins.2005 · DOI: 10.1074/jbc.m505729200 Photosystem II core phosphorylation and photosynthetic acclimation require two different protein kinases.2005 · DOI: 10.1038/nature04016 Light regulation of CaS, a novel phosphoprotein in the thylakoid membrane of Arabidopsis thaliana.2008 · DOI: 10.1111/j.1742-4658.2008.06335.x Visualizing the mobility and distribution of chlorophyll proteins in higher plant thylakoid membranes: effects of photoinhibition and protein phosphorylation.2010 · DOI: 10.1111/j.0960-7412.2010.04207.x
`At1g68830`	Serine/threonine protein kinase required for state transition by phosphorylating light-harvesting complex II outer antennae (LCHII).	State transitions and light adaptation require chloroplast thylakoid protein kinase STN7.2005 · DOI: 10.1038/nature03286 Photosystem II core phosphorylation and photosynthetic acclimation require two different protein kinases.2005 · DOI: 10.1038/nature04016 State transitions revisited-a buffering system for dynamic low light acclimation of Arabidopsis.2006 · DOI: 10.1007/s11103-006-9044-8 Intrinsically unstructured phosphoprotein TSP9 regulates light harvesting in Arabidopsis thaliana.2009 · DOI: 10.1021/bi8016334 Arabidopsis STN7 kinase provides a link between short- and long-term photosynthetic acclimation.2009 · DOI: 10.1105/tpc.108.064964 Phosphoproteomics of Arabidopsis chloroplasts reveals involvement of the STN7 kinase in phosphorylation of nucleoid protein pTAC16.2012 · DOI: 10.1016/j.febslet.2012.03.061
`At1g12680`	Serine/threonine-protein kinase PEPKR2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035943 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0009643 photosynthetic acclimation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042149 cellular response to glucose starvation Biological Process

GO:0042548 regulation of photosynthesis, light reaction Biological Process

GO:0042549 photosystem II stabilization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009579 thylakoid Cellular Component

KEGG gene cross-reference

ath:AT1G12680

ath:AT1G68830

ath:AT5G01920

mmu:381393

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_035943 · OH-1004

Mitochondrion0.023

Rank 2 · LXL04_035943 · OH-1004

Nucleus0.020

Rank 3 · LXL04_035943 · OH-1004

Cytoplasm0.016

Rank 4 · LXL04_035943 · OH-1004

Cell membrane0.014

Rank 5 · LXL04_035943 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr243-362 aa

PF03109.23ABC1276-340 aa

PF00069.32Pkinase291-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035943	`PF07714.24`	PK_Tyr_Ser-Thr	243	362	4.4e-11	43.3
LXL04_035943	`PF03109.23`	ABC1	276	340	1.5e-07	31.6
LXL04_035943	`PF00069.32`	Pkinase	291	362	5e-25	89.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZV4`	Arabidopsis thaliana	Serine/threonine-protein kinase STN8, chloroplastic	72.294%	Swiss-Prot	strong database homology
`Q9S713`	Arabidopsis thaliana	Serine/threonine-protein kinase STN7, chloroplastic	41.769%	Swiss-Prot	moderate database homology
`Q8W490`	Arabidopsis thaliana	Serine/threonine-protein kinase PEPKR2	28.049%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card