LXL04_035942 | RubberDandelionOmics

Gene overview

LXL04_035942

Reference: OH-1004 Chr: Chr08 Coordinates: 32554559-32556688 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · LXL04_035942|LXL04_035942|OH1004|cDNA

ATGGCTGAACAAACTTCATCCGAATCCAAAGAGGATATTCCTGAAATTACCCCCTTTGATCCcacaaagaaaaagaagaagaaaaaggttGTAATCCAAGATATCGCGGAGGAAGATCGCTTATCTGAGAAGATAGATAACCTAACACTTGCTGATGGAGTAGAAAATGCATTTGTGGGTatgaaaaaaaagaaaaagaaaccaGTGGGAAGTGATTTGACAAATGATGGAAGTCCCCAAACAGGTCAAGGTGGTGAGGA...

CDS

Download CDS FASTA

786 bp · LXL04_035942|LXL04_035942|OH1004|CDS

ATGGCTGAACAAACTTCATCCGAATCCAAAGAGGATATTCCTGAAATTACCCCCTTTGATCCCACAAAGAAAAAGAAGAAGAAAAAGGTTGTAATCCAAGATATCGCGGAGGAAGATCGCTTATCTGAGAAGATAGATAACCTAACACTTGCTGATGGAGTAGAAAATGCATTTGTGGGTATGAAAAAAAAGAAAAAGAAACCAGTGGGAAGTGATTTGACAAATGATGGAAGTCCCCAAACAGGTCAAGGTGGTGAGGA...

Protein

Download Protein FASTA

261 aa · LXL04_035942|LXL04_035942|OH1004|PROTEIN

MAEQTSSESKEDIPEITPFDPTKKKKKKKVVIQDIAEEDRLSEKIDNLTLADGVENAFVGMKKKKKKPVGSDLTNDGSPQTGQGGEEEEDPNNSRQKYPWEGTDRDYLYEELLSRVFHILRENNPELAGDRRRTVIRPPQVLREGTKKTVFVNFMDLCRTMHRQPDHVMTFLLAEMGTSGSLDGQQRLVVKGRFAPKNFEGILRRYINEYVICNGCRSPDTILSKENRLFFLRCEQCGSGRSVAPIKTGFVARVGRRKAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035942`
TK1151 ID	TkA04G094400
OH-1004 ID	LXL04_035942
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035942

Location Chr08:32554559-32556688 (+)

Description Similar to Eukaryotic translation initiation factor 2 subunit beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20920`	Component of the eIF2 complex that functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035942 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001731 formation of translation preinitiation complex Biological Process

GO:0002176 male germ cell proliferation Biological Process

GO:0002183 cytoplasmic translational initiation Biological Process

GO:0006413 translational initiation Biological Process

GO:0006446 regulation of translational initiation Biological Process

GO:0007284 spermatogonial cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005850 eukaryotic translation initiation factor 2 complex Cellular Component

GO:0009536 plastid Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G20920

bta:520094

mmu:67204

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.703

Rank 1 · LXL04_035942 · OH-1004

Nucleus0.322

Rank 2 · LXL04_035942 · OH-1004

Cell membrane0.065

Rank 3 · LXL04_035942 · OH-1004

Endoplasmic reticulum0.061

Rank 4 · LXL04_035942 · OH-1004

Golgi apparatus0.040

Rank 5 · LXL04_035942 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01873.24eIF-5_eIF-2B130-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035942	`PF01873.24`	eIF-5_eIF-2B	130	239	7.7e-40	136.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q41969`	Arabidopsis thaliana	Eukaryotic translation initiation factor 2 subunit beta	70.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card