LXL04_035917 | RubberDandelionOmics

Gene overview

LXL04_035917

Reference: OH-1004 Chr: Chr08 Coordinates: 32062938-32065299 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1422 bp · LXL04_035917|LXL04_035917|OH1004|cDNA

ATGGAGCTCACCATTGCAATGGTGGTTGCATTAGCCCTTGTGCTTCTAGCAGTCGCCTTTCTTCGTGCAAACGCTTTCCCAAAAGAAATGGATGTGATCCCAGGTAGCCTTGGTTGGCCAGTCATAGGCGAGAGTTTCTCTTTCATATCCGAATTCTCAAGTCCAGCTGGCATTTTCAGTTTCATGAACAAAAGGCAACAAAAaTATGGGAAGGTGTTTAAGAGCTATGTATTAGGACGGTATATGGTGTTCACGACTGG...

CDS

Download CDS FASTA

1422 bp · LXL04_035917|LXL04_035917|OH1004|CDS

ATGGAGCTCACCATTGCAATGGTGGTTGCATTAGCCCTTGTGCTTCTAGCAGTCGCCTTTCTTCGTGCAAACGCTTTCCCAAAAGAAATGGATGTGATCCCAGGTAGCCTTGGTTGGCCAGTCATAGGCGAGAGTTTCTCTTTCATATCCGAATTCTCAAGTCCAGCTGGCATTTTCAGTTTCATGAACAAAAGGCAACAAAAATATGGGAAGGTGTTTAAGAGCTATGTATTAGGACGGTATATGGTGTTCACGACTGG...

Protein

Download Protein FASTA

473 aa · LXL04_035917|LXL04_035917|OH1004|PROTEIN

MELTIAMVVALALVLLAVAFLRANAFPKEMDVIPGSLGWPVIGESFSFISEFSSPAGIFSFMNKRQQKYGKVFKSYVLGRYMVFTTGREASKVLLTGKDGMVSLNLFTTGQKVLGPNSLLQQNGEDHKRLRRLIAEPLSIDGLKKYFQFINDLAIQMFDRWDGQKVLVLEEASTFTLKVIGNMIMSLEPEGEEQEKFRDYFRIISSSFASLPFNIPGTAFYRGMKARDGMFEMLDTIIARRRNGSDLQQDFLGSLIKKHG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035917`
TK1151 ID	TkA04G096730
OH-1004 ID	LXL04_035917
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035917

Location Chr08:32062938-32065299 (+)

Description Similar to CYP707A3: Abscisic acid 8'-hydroxylase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45340`	Participates in ABA oxidative degradation but does not catalyze the isomerization of 8′-hydroxy-ABA to (−)-phaseic acid.	Arabidopsis CYP707As encode (+)-abscisic acid 8'-hydroxylase, a key enzyme in the oxidative catabolism of abscisic acid.2004 · DOI: 10.1104/pp.103.037614 CYP707A3, a major ABA 8'-hydroxylase involved in dehydration and rehydration response in Arabidopsis thaliana.2006 · DOI: 10.1111/j.1365-313x.2006.02683.x
`At4g19230`	Involved in the oxidative degradation of abscisic acid.	The Arabidopsis cytochrome P450 CYP707A encodes ABA 8'-hydroxylases: key enzymes in ABA catabolism.2004 · DOI: 10.1038/sj.emboj.7600121 Arabidopsis CYP707As encode (+)-abscisic acid 8'-hydroxylase, a key enzyme in the oxidative catabolism of abscisic acid.2004 · DOI: 10.1104/pp.103.037614 CYP707A1 and CYP707A2, which encode abscisic acid 8'-hydroxylases, are indispensable for proper control of seed dormancy and germination in Arabidopsis.2006 · DOI: 10.1104/pp.106.079475

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0703600`	Involved in the oxidative degradation of abscisic acid.	No verified direct reference in this release
`UniProt: Q09J79`	Involved in the oxidative degradation of abscisic acid.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035917 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009687 abscisic acid metabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009835 fruit ripening Biological Process

GO:0016125 sterol metabolic process Biological Process

GO:0046345 abscisic acid catabolic process Biological Process

GO:0048838 release of seed from dormancy Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT4G19230

ath:AT5G45340

sly:101249565

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.916

Rank 1 · LXL04_035917 · OH-1004

Cytoplasm0.049

Rank 2 · LXL04_035917 · OH-1004

Golgi apparatus0.033

Rank 3 · LXL04_035917 · OH-1004

Cell membrane0.033

Rank 4 · LXL04_035917 · OH-1004

Nucleus0.032

Rank 5 · LXL04_035917 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45034-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035917	`PF00067.28`	p450	34	459	9.1e-76	256.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FH76`	Arabidopsis thaliana	Abscisic acid 8'-hydroxylase 3	34.542%	Swiss-Prot	moderate database homology
`Q949P1`	Arabidopsis thaliana	Abscisic acid 8'-hydroxylase 1	34.783%	Swiss-Prot	moderate database homology
`Q05JG2`	Oryza sativa subsp. japonica	Abscisic acid 8'-hydroxylase 1	34.534%	Swiss-Prot	moderate database homology
`Q09J79`	Oryza sativa subsp. indica	Abscisic acid 8'-hydroxylase 1	34.534%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card