LXL04_035892 | RubberDandelionOmics

Gene overview

LXL04_035892

Reference: OH-1004 Chr: Chr08 Coordinates: 31512519-31514370 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1392 bp · LXL04_035892|LXL04_035892|OH1004|cDNA

ATGGTGGAGGTAAAAGTCTCAGAAACCCGAGACCTAACCCGAATCGAACGAATCGGGGCCCACTCACACATCCGCGGTCTTGGTCTCGATTCCGCCCTCGAACCCCGCGCCATCTCCGAAGGCATGGTGGGCCAAACCACCGCCCGCAAAGCCGCCGGAGTCATCGTCCAAATGGTCAAAGACGGCAAAATCGCGGGTCGAGCCGTCCTCCTCGCGGGCCAACCCGGAACCGGCAAAACCGCCATAGCCATGGGCATGGC...

CDS

Download CDS FASTA

1392 bp · LXL04_035892|LXL04_035892|OH1004|CDS

ATGGTGGAGGTAAAAGTCTCAGAAACCCGAGACCTAACCCGAATCGAACGAATCGGGGCCCACTCACACATCCGCGGTCTTGGTCTCGATTCCGCCCTCGAACCCCGCGCCATCTCCGAAGGCATGGTGGGCCAAACCACCGCCCGCAAAGCCGCCGGAGTCATCGTCCAAATGGTCAAAGACGGCAAAATCGCGGGTCGAGCCGTCCTCCTCGCGGGCCAACCCGGAACCGGCAAAACCGCCATAGCCATGGGCATGGC...

Protein

Download Protein FASTA

463 aa · LXL04_035892|LXL04_035892|OH1004|PROTEIN

MVEVKVSETRDLTRIERIGAHSHIRGLGLDSALEPRAISEGMVGQTTARKAAGVIVQMVKDGKIAGRAVLLAGQPGTGKTAIAMGMAKSIGLETPFAMLAGSELFSLEMSKTEALMQAFRKAIGVRIKEETEVIEGEVVEIQIDRPAVAGSASKTGKLTLKTTEMETVYDLGAKMIEALGKDKVQSGDVIAIDKASGKITKLGRSFSRSRDYDAMGPQTKFVQCPDGELQKRKEVVHCVTLHEIDVINSRTQGFLALFTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035892`
TK1151 ID	TkA04G098630
OH-1004 ID	LXL04_035892
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_035892`
Location	Chr08:31512519-31514370 (-)
Description	Similar to ruvbl2: RuvB-like 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035892` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000492 box C/D snoRNP assembly Biological Process GO:0000723 telomere maintenance Biological Process GO:0003351 epithelial cilium movement involved in extracellular fluid movement Biological Process GO:0006275 regulation of DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006282 regulation of DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006457 protein folding Biological Process
KEGG gene cross-reference	bta:511048 dre:317678 hsa:10856 mmu:20174 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.575

Rank 1 · LXL04_035892 · OH-1004

Nucleus0.421

Rank 2 · LXL04_035892 · OH-1004

Mitochondrion0.077

Rank 3 · LXL04_035892 · OH-1004

Cell membrane0.070

Rank 4 · LXL04_035892 · OH-1004

Endoplasmic reticulum0.050

Rank 5 · LXL04_035892 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06068.20TIP4917-362 aa

PF05496.19RuvB_N35-93 aa

PF03796.22DnaB_C65-193 aa

PF00004.36AAA69-121 aa

PF17856.8TIP49_C367-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035892	`PF06068.20`	TIP49	17	362	2.5e-166	553.8
LXL04_035892	`PF05496.19`	RuvB_N	35	93	1.2e-07	32.3
LXL04_035892	`PF03796.22`	DnaB_C	65	193	3e-07	30.8
LXL04_035892	`PF00004.36`	AAA	69	121	2.8e-09	38.2
LXL04_035892	`PF17856.8`	TIP49_C	367	432	2.4e-24	86.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card