LXL04_035856 | RubberDandelionOmics

Gene overview

LXL04_035856

Reference: OH-1004 Chr: Chr08 Coordinates: 30703669-30714153 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3624 bp · LXL04_035856|LXL04_035856|OH1004|cDNA

ATGGGGGATGGGGTGGAAGTGAAAATTATCACTCTTCTTCTATTAAGCAACTATTTCCAAAACGCCATGTTGCTGCTCGCTATGATGTTGTACATCCGTAGCCACTTCCGGCGAGAGCTTTTCTCAATCCATCACTTCAGATCTCAACTTTTATACTCAACAGCCGCTAAATTTTCACATTCTGGTGAATATTCTGCCAAAAGAACCGAGTTCATTGATTATCTCATCAACACACTCGGATTCTCCAAAGAATCCGCCAT...

CDS

Download CDS FASTA

3624 bp · LXL04_035856|LXL04_035856|OH1004|CDS

ATGGGGGATGGGGTGGAAGTGAAAATTATCACTCTTCTTCTATTAAGCAACTATTTCCAAAACGCCATGTTGCTGCTCGCTATGATGTTGTACATCCGTAGCCACTTCCGGCGAGAGCTTTTCTCAATCCATCACTTCAGATCTCAACTTTTATACTCAACAGCCGCTAAATTTTCACATTCTGGTGAATATTCTGCCAAAAGAACCGAGTTCATTGATTATCTCATCAACACACTCGGATTCTCCAAAGAATCCGCCAT...

Protein

Download Protein FASTA

1207 aa · LXL04_035856|LXL04_035856|OH1004|PROTEIN

MGDGVEVKIITLLLLSNYFQNAMLLLAMMLYIRSHFRRELFSIHHFRSQLLYSTAAKFSHSGEYSAKRTEFIDYLINTLGFSKESAISSVSKVRRFNTTRNCDSVIHLLKNFGFDDAQVKDIVACVPQVLLYKANETVEPKIRVFIELGLSGPDLISFLKRNPSLFEIGLHSRIIPTIDYLRNLLGTNEKVVDIIKRSRWLFTTSVAMKMLSNNVMLLQTYGLSNEQIGKFVNRNAMHFTQSPDWLTSKLNWIEGKLGVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035856`
TK1151 ID	TkA04G102450
OH-1004 ID	LXL04_035856
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 92.402 / OH-1004 31.234 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035856

Location Chr08:30703669-30714153 (+)

Description Similar to MTERF5: Transcription termination factor MTERF5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14605`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	Arabidopsis MDA1, a nuclear-encoded protein, functions in chloroplast development and abiotic stress responses.2012 · DOI: 10.1371/journal.pone.0042924 mTERF5 Acts as a Transcriptional Pausing Factor to Positively Regulate Transcription of Chloroplast psbEFLJ.2019 · DOI: 10.1016/j.molp.2019.05.007
`At2g21710`	Transcription termination factor involved in processing of plastid transcripts (By similarity).	No verified direct reference in this release
`At5g55580`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	Mutations in the plant-conserved MTERF9 alter chloroplast gene expression, development and tolerance to abiotic stress in Arabidopsis thaliana.2015 · DOI: 10.1111/ppl.12307
`At3g60400`	Transcription termination factor involved in the regulation of mitochondrial-encoded gene expression.	Mutations in an Arabidopsis mitochondrial transcription termination factor-related protein enhance thermotolerance in the absence of the major molecular chaperone HSP101.2012 · DOI: 10.1105/tpc.112.101006
`At4g38160`	Transcription termination factor essential for chloroplast development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035856 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042793 plastid transcription Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:1990837 sequence-specific double-stranded DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G21710

ath:AT4G14605

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.755

Rank 1 · LXL04_035856 · OH-1004

Plastid0.174

Rank 2 · LXL04_035856 · OH-1004

Cytoplasm0.058

Rank 3 · LXL04_035856 · OH-1004

Nucleus0.038

Rank 4 · LXL04_035856 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_035856 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02536.20mTERF73-250 aa

PF02536.20mTERF174-382 aa

PF02536.20mTERF531-811 aa

PF02536.20mTERF905-994 aa

PF02536.20mTERF973-1181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035856	`PF02536.20`	mTERF	73	250	2e-106	356.2
LXL04_035856	`PF02536.20`	mTERF	174	382	2e-106	356.2
LXL04_035856	`PF02536.20`	mTERF	531	811	2e-106	356.2
LXL04_035856	`PF02536.20`	mTERF	905	994	2e-106	356.2
LXL04_035856	`PF02536.20`	mTERF	973	1181	2e-106	356.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JVI3`	Arabidopsis thaliana	Transcription termination factor MTERF5, chloroplastic	25.296%	Swiss-Prot	weak database homology
`F4IHL3`	Arabidopsis thaliana	Transcription termination factor MTERF2, chloroplastic	21.951%	Swiss-Prot	weak database homology
`Q9FM80`	Arabidopsis thaliana	Transcription termination factor MTERF9, chloroplastic	25.221%	Swiss-Prot	weak database homology
`Q9M219`	Arabidopsis thaliana	Transcription termination factor MTEF18, mitochondrial	22.884%	Swiss-Prot	weak database homology
`Q9SZL6`	Arabidopsis thaliana	Transcription termination factor MTERF6, chloroplastic/mitochondrial	22.846%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card