LXL04_035823 | RubberDandelionOmics

Gene overview

LXL04_035823

Reference: OH-1004 Chr: Chr08 Coordinates: 29661753-29664239 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1527 bp · LXL04_035823|LXL04_035823|OH1004|cDNA

ATGAAGACTATAAATTCAAAAAGTCAACTATTGGGGattgtttatgtgtttgctcTTTTCAACATTTGCAATGGAAGAAGAACCATCATGAAATCAAACAATGAGTTGATCAGAGCCGTTAATCTTGGAGGCTGGCTCGTTACTGAAGGCTGGATGAAACCATCTCTCTTTGATTCCATTCCAAACAATGATTTCCTGGATGGAGTTGGACTTCAGTTCAAATCAGTTACTACTGGGAAATTCCTTGCTGCGGAGCTCGG...

CDS

Download CDS FASTA

1527 bp · LXL04_035823|LXL04_035823|OH1004|CDS

ATGAAGACTATAAATTCAAAAAGTCAACTATTGGGGATTGTTTATGTGTTTGCTCTTTTCAACATTTGCAATGGAAGAAGAACCATCATGAAATCAAACAATGAGTTGATCAGAGCCGTTAATCTTGGAGGCTGGCTCGTTACTGAAGGCTGGATGAAACCATCTCTCTTTGATTCCATTCCAAACAATGATTTCCTGGATGGAGTTGGACTTCAGTTCAAATCAGTTACTACTGGGAAATTCCTTGCTGCGGAGCTCGG...

Protein

Download Protein FASTA

508 aa · LXL04_035823|LXL04_035823|OH1004|PROTEIN

MKTINSKSQLLGIVYVFALFNICNGRRTIMKSNNELIRAVNLGGWLVTEGWMKPSLFDSIPNNDFLDGVGLQFKSVTTGKFLAAELGGGSIIVANRTSASGWETFRLWRINETSFHVRVFNKQFLGIDSMGIKLVAISTDSEKSGVFEIIRKSDDPSRVRIKAPNGLFLQAKTEDLVTADSHRDTQWEDNDPSVFEMTIIERLRGEYQVTSGYGPLKAPKIMKDHWDTFITEKDFSFIAASGLNGVRIPVGWWTTKDPTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035823`
TK1151 ID	TkA04G105890
OH-1004 ID	LXL04_035823
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_035823`
Location	Chr08:29661753-29664239 (+)
Description	Similar to exgA: Probable glucan 1,3-beta-glucosidase A (Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035823` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0009251 glucan catabolic process Biological Process GO:0071555 cell wall organization Biological Process GO:0005576 extracellular region Cellular Component GO:0009986 cell surface Cellular Component GO:0004338 glucan exo-1,3-beta-glucosidase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	afm:AFUA_1G03600 ani:ANIA_04052 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.628

Rank 1 · LXL04_035823 · OH-1004

Cytoplasm0.122

Rank 2 · LXL04_035823 · OH-1004

Lysosome / Vacuole0.099

Rank 3 · LXL04_035823 · OH-1004

Endoplasmic reticulum0.070

Rank 4 · LXL04_035823 · OH-1004

Cell membrane0.042

Rank 5 · LXL04_035823 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25490.1DUF791062-200 aa

PF00150.25Cellulase224-490 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035823	`PF25490.1`	DUF7910	62	200	1.6e-58	197.4
LXL04_035823	`PF00150.25`	Cellulase	224	490	1.2e-19	71.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card