LXL04_035780 | RubberDandelionOmics

Gene overview

LXL04_035780

Reference: OH-1004 Chr: Chr08 Coordinates: 28640540-28641907 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

972 bp · LXL04_035780|LXL04_035780|OH1004|cDNA

ATGTCGAAATCATTAAAACTCACAAGTCCAACAAGGATTTCCCAATTTGGGTTCGTTGTTATTGTGATTATTGCTAGGCTAACATTCGCAGATAAGAACCCTAGGGTTTCCAATTCTATTTCTATATGTCCTCCCAAATCGATTAACGATTCAATTTTTGGTGCCCAAGCTCCGGTTTGTCCTTTAAAAGGGGTTGATTATTCTCTCGGGGTTATGGAGGGAGACGAGACGTCATTGCAAAAGGCGTTAAGTATGGTTCA...

CDS

Download CDS FASTA

972 bp · LXL04_035780|LXL04_035780|OH1004|CDS

ATGTCGAAATCATTAAAACTCACAAGTCCAACAAGGATTTCCCAATTTGGGTTCGTTGTTATTGTGATTATTGCTAGGCTAACATTCGCAGATAAGAACCCTAGGGTTTCCAATTCTATTTCTATATGTCCTCCCAAATCGATTAACGATTCAATTTTTGGTGCCCAAGCTCCGGTTTGTCCTTTAAAAGGGGTTGATTATTCTCTCGGGGTTATGGAGGGAGACGAGACGTCATTGCAAAAGGCGTTAAGTATGGTTCA...

Protein

Download Protein FASTA

323 aa · LXL04_035780|LXL04_035780|OH1004|PROTEIN

MSKSLKLTSPTRISQFGFVVIVIIARLTFADKNPRVSNSISICPPKSINDSIFGAQAPVCPLKGVDYSLGVMEGDETSLQKALSMVHTNTQDYVVVLFYASWCPFSITFRPTLSPMSSLYPSIAHFAIEESVIRPSILSKYGVHGFPTLFVLNSTMRVRYHGSRTLTSLVAFYTNVTGIKSESVNETSLGKTIHEHANQKINEPESCPFSWARSPENMLRHETYLTLATIFVLLRLSYLGYPFIKTCARVSWRRRNVNIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035780`
TK1151 ID	TkA04G109400
OH-1004 ID	LXL04_035780
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035780

Location Chr08:28640540-28641907 (+)

Description Similar to APRL4: 5'-adenylylsulfate reductase-like 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34780`	5'-adenylylsulfate reductase-like 4.	No verified direct reference in this release
`At4g08930`	5'-adenylylsulfate reductase-like 6.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0754900`	5'-adenylylsulfate reductase-like 3.	No verified direct reference in this release
`Os06g0220800`	5'-adenylylsulfate reductase-like 2.	No verified direct reference in this release
`Os08g0412401`	5'-adenylylsulfate reductase-like 4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035780 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

GO:0016853 isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G34780

ath:AT4G08930

dosa:Os02g0754900

dosa:Os06g0220800

dosa:Os08g0412401

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.402

Rank 1 · LXL04_035780 · OH-1004

Golgi apparatus0.245

Rank 2 · LXL04_035780 · OH-1004

Nucleus0.169

Rank 3 · LXL04_035780 · OH-1004

Cell membrane0.136

Rank 4 · LXL04_035780 · OH-1004

Cytoplasm0.108

Rank 5 · LXL04_035780 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin90-172 aa

PF27914.1APRL7_C216-281 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035780	`PF00085.27`	Thioredoxin	90	172	2.3e-08	34.7
LXL04_035780	`PF27914.1`	APRL7_C	216	281	3.4e-13	50.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA00`	Arabidopsis thaliana	5'-adenylylsulfate reductase-like 4	53.846%	Swiss-Prot	strong database homology
`Q9ZPE9`	Arabidopsis thaliana	5'-adenylylsulfate reductase-like 6	50.730%	Swiss-Prot	strong database homology
`Q84P95`	Oryza sativa subsp. japonica	5'-adenylylsulfate reductase-like 3	47.386%	Swiss-Prot	moderate database homology
`Q67VZ8`	Oryza sativa subsp. japonica	5'-adenylylsulfate reductase-like 2	44.000%	Swiss-Prot	moderate database homology
`Q5DJV7`	Oryza sativa subsp. japonica	5'-adenylylsulfate reductase-like 4	44.749%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card