LXL04_035761 | RubberDandelionOmics

Gene overview

LXL04_035761

Reference: OH-1004 Chr: Chr08 Coordinates: 28416539-28418177 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

726 bp · LXL04_035761|LXL04_035761|OH1004|cDNA

ATGTCGCAACAGCGGAATTCGAACTTGTATAGCATAATAGTGCCAACTTACAACGAACGACTCAACATCGCTCTCATCGTCTACCTCGTCTTCAAGCATATTCCGGACATTAACTTTGAAATAATAATTGTGGACGATGGTAGTCCAGATGGAACTCAAGATATTGTCAAGCAATTACAGAAAGTCTATGGTGATGATCGCATTCTATTAAGACCCAGACCCAAAAAGCTCGGATTAGGGACTGCATACATTCATGGTCT...

CDS

Download CDS FASTA

726 bp · LXL04_035761|LXL04_035761|OH1004|CDS

ATGTCGCAACAGCGGAATTCGAACTTGTATAGCATAATAGTGCCAACTTACAACGAACGACTCAACATCGCTCTCATCGTCTACCTCGTCTTCAAGCATATTCCGGACATTAACTTTGAAATAATAATTGTGGACGATGGTAGTCCAGATGGAACTCAAGATATTGTCAAGCAATTACAGAAAGTCTATGGTGATGATCGCATTCTATTAAGACCCAGACCCAAAAAGCTCGGATTAGGGACTGCATACATTCATGGTCT...

Protein

Download Protein FASTA

241 aa · LXL04_035761|LXL04_035761|OH1004|PROTEIN

MSQQRNSNLYSIIVPTYNERLNIALIVYLVFKHIPDINFEIIIVDDGSPDGTQDIVKQLQKVYGDDRILLRPRPKKLGLGTAYIHGLKHASGNFVIIMDADLSHHPKYLPQFIKKQMETGASIVTGTRYVTGGGVHGWTLMRKLTSRGANVLAHTLLWPGVSDLTGSFRLYKKSVLEDIISSCVSKGYVFQMEMIVRASRKGYHIEEVPITFVDRVYGSSKLGGSEIVEYLKGLVYLLVTT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035761`
TK1151 ID	TkA04G110180
OH-1004 ID	LXL04_035761
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035761

Location Chr08:28416539-28418177 (-)

Description Similar to DPMS1: Dolichol-phosphate mannosyltransferase subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20575`	Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.	DOLICHOL PHOSPHATE MANNOSE SYNTHASE1 mediates the biogenesis of isoprenyl-linked glycans and influences development, stress response, and ammonium hypersensitivity in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083634

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035761 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process

GO:0006506 GPI anchor biosynthetic process Biological Process

GO:0035269 protein O-linked glycosylation via mannose Biological Process

GO:0043048 dolichyl monophosphate biosynthetic process Biological Process

GO:0060359 response to ammonium ion Biological Process

GO:0070482 response to oxygen levels Biological Process

GO:0180047 dolichol phosphate mannose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0033185 dolichol-phosphate-mannose synthase complex Cellular Component

KEGG gene cross-reference

ath:AT1G20575

cge:100689420

hsa:8813

mmu:13480

ssc:100124379

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.606

Rank 1 · LXL04_035761 · OH-1004

Cytoplasm0.171

Rank 2 · LXL04_035761 · OH-1004

Golgi apparatus0.123

Rank 3 · LXL04_035761 · OH-1004

Cell membrane0.099

Rank 4 · LXL04_035761 · OH-1004

Mitochondrion0.098

Rank 5 · LXL04_035761 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13641.13Glyco_tranf_2_310-218 aa

PF00535.33Glycos_transf_211-179 aa

PF10111.15Glyco_tranf_2_211-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035761	`PF13641.13`	Glyco_tranf_2_3	10	218	2.2e-10	41.4
LXL04_035761	`PF00535.33`	Glycos_transf_2	11	179	1.4e-39	136.4
LXL04_035761	`PF10111.15`	Glyco_tranf_2_2	11	109	3.3e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LM93`	Arabidopsis thaliana	Dolichol-phosphate mannosyltransferase subunit 1	87.500%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card