LXL04_035716 | RubberDandelionOmics

Gene overview

LXL04_035716

Reference: OH-1004 Chr: Chr08 Coordinates: 27626988-27630835 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1716 bp · LXL04_035716|LXL04_035716|OH1004|cDNA

ATGGGTAACACTTGTGTTGGACCAAATATCACAAAAAATGGATTCATCCAATCCGTTTCAGCTGCAATGTGGCGCACCCCAGCTGATTCCTCCCCACCTACTCCAAAAGGCGAACAATCAAACCACAACAAACAACCCGAATCACCATTACCCGTTCAAAACAAACCACCCGAACAAATCACAATCCCAAAACCCGAAAAGAAACAAGAACACCATCAACAACAACCTGTAAAACCCAAAAAAGCCCCTCAAATGAAACG...

CDS

Download CDS FASTA

1716 bp · LXL04_035716|LXL04_035716|OH1004|CDS

ATGGGTAACACTTGTGTTGGACCAAATATCACAAAAAATGGATTCATCCAATCCGTTTCAGCTGCAATGTGGCGCACCCCAGCTGATTCCTCCCCACCTACTCCAAAAGGCGAACAATCAAACCACAACAAACAACCCGAATCACCATTACCCGTTCAAAACAAACCACCCGAACAAATCACAATCCCAAAACCCGAAAAGAAACAAGAACACCATCAACAACAACCTGTAAAACCCAAAAAAGCCCCTCAAATGAAACG...

Protein

Download Protein FASTA

571 aa · LXL04_035716|LXL04_035716|OH1004|PROTEIN

MGNTCVGPNITKNGFIQSVSAAMWRTPADSSPPTPKGEQSNHNKQPESPLPVQNKPPEQITIPKPEKKQEHHQQQPVKPKKAPQMKRVSSAGLRTDSVLQRKTGSLKEFFTLGKKLGQGQFGTTFLCIEKATGEQYACKSIAKRKLLTDEDVEDVRREIQIMHHLAGHPNVIAIKGAYEDAVAVHVVMELCAGGELFDRIIQRGHYTEKKASELTRTIVGVVETCHSLGVMHRDLKPENFLLVDKKEDALLKTIDFGLSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035716`
TK1151 ID	TkA04G113820
OH-1004 ID	LXL04_035716
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035716

Location Chr08:27626988-27630835 (+)

Description Similar to CPK1: Calcium-dependent protein kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04870`	May play a role in signal transduction pathways that involve calcium as a second messenger.	A calcium-dependent protein kinase can inhibit a calmodulin-stimulated Ca2+ pump (ACA2) located in the endoplasmic reticulum of Arabidopsis.2000 · DOI: 10.1073/pnas.97.11.6224
`At3g10660`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0788500`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`Os07g0161600`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`Os12g0486600`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035716 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:1900055 regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT3G10660

ath:AT5G04870

dosa:Os03g0788500

dosa:Os07g0161600

osa:4342456

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.507

Rank 1 · LXL04_035716 · OH-1004

Cytoplasm0.391

Rank 2 · LXL04_035716 · OH-1004

Nucleus0.202

Rank 3 · LXL04_035716 · OH-1004

Golgi apparatus0.101

Rank 4 · LXL04_035716 · OH-1004

Endoplasmic reticulum0.071

Rank 5 · LXL04_035716 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase111-368 aa

PF07714.24PK_Tyr_Ser-Thr111-362 aa

PF00036.39EF-hand_1416-442 aa

PF13499.13EF-hand_7416-475 aa

PF13405.13EF-hand_6416-444 aa

PF13202.13EF-hand_5416-437 aa

PF13833.13EF-hand_8430-476 aa

PF00036.39EF-hand_1451-475 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035716	`PF00069.32`	Pkinase	111	368	6.5e-78	262.5
LXL04_035716	`PF07714.24`	PK_Tyr_Ser-Thr	111	362	5.5e-26	92.1
LXL04_035716	`PF00036.39`	EF-hand_1	416	442	2.5e-31	105.6
LXL04_035716	`PF13499.13`	EF-hand_7	416	475	3.1e-29	101.8
LXL04_035716	`PF13405.13`	EF-hand_6	416	444	4.9e-25	85.5
LXL04_035716	`PF13202.13`	EF-hand_5	416	437	2.7e-22	77.9
LXL04_035716	`PF13833.13`	EF-hand_8	430	476	5.1e-18	65.3
LXL04_035716	`PF00036.39`	EF-hand_1	451	475	2.5e-31	105.6
LXL04_035716	`PF13499.13`	EF-hand_7	485	546	3.1e-29	101.8
LXL04_035716	`PF00036.39`	EF-hand_1	489	512	2.5e-31	105.6
LXL04_035716	`PF13405.13`	EF-hand_6	489	516	4.9e-25	85.5
LXL04_035716	`PF13202.13`	EF-hand_5	491	509	2.7e-22	77.9
LXL04_035716	`PF00036.39`	EF-hand_1	521	546	2.5e-31	105.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q06850`	Arabidopsis thaliana	Calcium-dependent protein kinase 1	75.450%	Swiss-Prot	strong database homology
`Q38870`	Arabidopsis thaliana	Calcium-dependent protein kinase 2	80.381%	Swiss-Prot	strong database homology
`Q6F3A6`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 10	71.906%	Swiss-Prot	strong database homology
`Q7XIM0`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 17	69.217%	Swiss-Prot	strong database homology
`Q2QQR2`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 27	77.935%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card