LXL04_035712 | RubberDandelionOmics

Gene overview

LXL04_035712

Reference: OH-1004 Chr: Chr08 Coordinates: 27538063-27539677 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1344 bp · LXL04_035712|LXL04_035712|OH1004|cDNA

ATGAGAGAAATTCTGAACATACAAGGAGGCCAATGCGGCAACCAAATCGGCGCAAAGTTTTGGGAGGTCATCTGCGACGAGCACGGAATTGATGCCACCGGCCAATACAACGGTACCACCGCCGATCTCCAGCTCGAGCGCATCAATGTTTACTACAATGAAGCCTCCGGCGGCCGTTACGTTCCCCGTGCCGTTCTTATGGATCTGGAGCCTGGTACCATGGACAGCATCAGATCTGGTCCCTACGGTCAGATCTTCAG...

CDS

Download CDS FASTA

1344 bp · LXL04_035712|LXL04_035712|OH1004|CDS

ATGAGAGAAATTCTGAACATACAAGGAGGCCAATGCGGCAACCAAATCGGCGCAAAGTTTTGGGAGGTCATCTGCGACGAGCACGGAATTGATGCCACCGGCCAATACAACGGTACCACCGCCGATCTCCAGCTCGAGCGCATCAATGTTTACTACAATGAAGCCTCCGGCGGCCGTTACGTTCCCCGTGCCGTTCTTATGGATCTGGAGCCTGGTACCATGGACAGCATCAGATCTGGTCCCTACGGTCAGATCTTCAG...

Protein

Download Protein FASTA

447 aa · LXL04_035712|LXL04_035712|OH1004|PROTEIN

MREILNIQGGQCGNQIGAKFWEVICDEHGIDATGQYNGTTADLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDALQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035712`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035712

Location Chr08:27538063-27539677 (+)

Description Similar to TUBB1: Tubulin beta-1 chain

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75780`	Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers.	No verified direct reference in this release
`At1g20010`	Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0671900`	Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035712 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0007017 microtubule-based process Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G20010

ath:AT1G75780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.764

Rank 1 · LXL04_035712 · OH-1004

Mitochondrion0.148

Rank 2 · LXL04_035712 · OH-1004

Nucleus0.095

Rank 3 · LXL04_035712 · OH-1004

Cell membrane0.044

Rank 4 · LXL04_035712 · OH-1004

Golgi apparatus0.030

Rank 5 · LXL04_035712 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00091.32Tubulin3-212 aa

PF03953.23Tubulin_C262-383 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035712	`PF00091.32`	Tubulin	3	212	1.8e-64	218.2
LXL04_035712	`PF03953.23`	Tubulin_C	262	383	3.2e-40	137.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P12411`	Arabidopsis thaliana	Tubulin beta-1 chain	95.592%	Swiss-Prot	strong database homology
`P29513`	Arabidopsis thaliana	Tubulin beta-5 chain	94.896%	Swiss-Prot	strong database homology
`Q40665`	Oryza sativa subsp. japonica	Tubulin beta-3 chain	95.592%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card