LXL04_035672 | RubberDandelionOmics

Gene overview

LXL04_035672

Reference: OH-1004 Chr: Chr08 Coordinates: 26809618-26812318 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1593 bp · LXL04_035672|LXL04_035672|OH1004|cDNA

ATGGATATGGATTATAACGGGGATGTGGGTCGTCTTGACCCCGAATTGTTACAGCTCAATGAAGTCTCTTCCTTGGCTATCAAGTCAAATTCTTATGTTGCCGAGAAGCTCTTCGAGCAATGGCTTTCCCTTCCCGAAACCACTCTTTTGGTGAAATCATTGGTAACAAAGGCAAAATCAGGGCTTACATTGAATGTATCAACAGCAAGTTCAAGCCCTAAATCTGCTTGCAGTAATTCTGTGCCTCCACTTTCACCAAG...

CDS

Download CDS FASTA

1593 bp · LXL04_035672|LXL04_035672|OH1004|CDS

ATGGATATGGATTATAACGGGGATGTGGGTCGTCTTGACCCCGAATTGTTACAGCTCAATGAAGTCTCTTCCTTGGCTATCAAGTCAAATTCTTATGTTGCCGAGAAGCTCTTCGAGCAATGGCTTTCCCTTCCCGAAACCACTCTTTTGGTGAAATCATTGGTAACAAAGGCAAAATCAGGGCTTACATTGAATGTATCAACAGCAAGTTCAAGCCCTAAATCTGCTTGCAGTAATTCTGTGCCTCCACTTTCACCAAG...

Protein

Download Protein FASTA

530 aa · LXL04_035672|LXL04_035672|OH1004|PROTEIN

MDMDYNGDVGRLDPELLQLNEVSSLAIKSNSYVAEKLFEQWLSLPETTLLVKSLVTKAKSGLTLNVSTASSSPKSACSNSVPPLSPRSSSGSPRVAKQRAGPSVLSSPLKVVSEPVKEFIPQFYFQHGRPPPNDIKDKCLSRTNQFFYGHANGLSLEEFKPVTKEICMLPSFFSSTLFKKIDAASTGTVTRDAFVDYWINGNMLTKDTATQIYTLLKQPDLRYLTQDDFKPILRELLATHPGLEFLQSTPEFQERYAETV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035672`
TK1151 ID	TkAUNG002090
OH-1004 ID	LXL04_035672
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 68.491 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035672

Location Chr08:26809618-26812318 (-)

Description Similar to B''GAMMA: Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28900`	Probable regulatory subunit of type 2A protein phosphatase.	No verified direct reference in this release
`At5g28850`	Regulatory subunit of type 2A protein phosphatase.	No verified direct reference in this release
`At1g54450`	Probable regulatory subunit of type 2A protein phosphatase.	No verified direct reference in this release
`At5g44090`	Regulatory subunit of type 2A protein phosphatase.	No verified direct reference in this release
`At1g03960`	Probable regulatory subunit of type 2A protein phosphatase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035672 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000159 protein phosphatase type 2A complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0019888 protein phosphatase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G03960

ath:AT1G54450

ath:AT5G28850

ath:AT5G28900

ath:AT5G44090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.656

Rank 1 · LXL04_035672 · OH-1004

Nucleus0.243

Rank 2 · LXL04_035672 · OH-1004

Cell membrane0.146

Rank 3 · LXL04_035672 · OH-1004

Golgi apparatus0.067

Rank 4 · LXL04_035672 · OH-1004

Mitochondrion0.063

Rank 5 · LXL04_035672 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17958.8EF-hand_13207-296 aa

PF13499.13EF-hand_7312-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035672	`PF17958.8`	EF-hand_13	207	296	7.3e-33	112.9
LXL04_035672	`PF13499.13`	EF-hand_7	312	411	1.6e-13	51.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZQ4`	Arabidopsis thaliana	Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma	74.200%	Swiss-Prot	strong database homology
`Q5QIT3`	Arabidopsis thaliana	Serine/threonine protein phosphatase 2A regulatory subunit B''beta	74.200%	Swiss-Prot	strong database homology
`Q9SLI8`	Arabidopsis thaliana	Probable serine/threonine protein phosphatase 2A regulatory subunit B''delta	73.774%	Swiss-Prot	strong database homology
`Q9XGR4`	Arabidopsis thaliana	Serine/threonine protein phosphatase 2A regulatory subunit B''alpha	69.388%	Swiss-Prot	strong database homology
`Q84JI6`	Arabidopsis thaliana	Probable serine/threonine protein phosphatase 2A regulatory subunit B''epsilon	68.927%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card