LXL04_035670 | RubberDandelionOmics

Gene overview

LXL04_035670

Reference: OH-1004 Chr: Chr08 Coordinates: 26804524-26806413 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1197 bp · LXL04_035670|LXL04_035670|OH1004|cDNA

ATGGGTGTTTCAAGAGCCATGTCATCATCAATTCGAGAAGGAAAGTACAAAAGTCTACCAGATTCAATTCCCATCATCTCAAAACAACTACCAACCACTTTATTCCCTGATCAAAACCAAATGGTGTCAGTGAATCCAACTCTTTCAGCTCCATCAATCTCCATGTCATCAACTGACACAGTCTCATTTCCACCAAACCAAACTCCCAATTTTGTAAATTCACAGTCACTCCCATTAGTCAGTTACCAAACTGATGATAT...

CDS

Download CDS FASTA

1197 bp · LXL04_035670|LXL04_035670|OH1004|CDS

ATGGGTGTTTCAAGAGCCATGTCATCATCAATTCGAGAAGGAAAGTACAAAAGTCTACCAGATTCAATTCCCATCATCTCAAAACAACTACCAACCACTTTATTCCCTGATCAAAACCAAATGGTGTCAGTGAATCCAACTCTTTCAGCTCCATCAATCTCCATGTCATCAACTGACACAGTCTCATTTCCACCAAACCAAACTCCCAATTTTGTAAATTCACAGTCACTCCCATTAGTCAGTTACCAAACTGATGATAT...

Protein

Download Protein FASTA

398 aa · LXL04_035670|LXL04_035670|OH1004|PROTEIN

MGVSRAMSSSIREGKYKSLPDSIPIISKQLPTTLFPDQNQMVSVNPTLSAPSISMSSTDTVSFPPNQTPNFVNSQSLPLVSYQTDDISWSAESLKDLLDFPENVAGDSQTALIPAGDRGKGTDWWADQLLSVDDNIESNWSDIMADVDVPTLDTTKQMQIIPRPPVPSIEVCPVSSPSSNGSSVKPRMRWTPELHESFVEAVNQLGGSERATPKGVLKLMNIESLTIYHVKSHLQKYRTARYKPELSEGTSEKKPTSLDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035670`
TK1151 ID	TkAUNG002110
OH-1004 ID	LXL04_035670
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 64.070 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035670

Location Chr08:26804524-26806413 (+)

Description Similar to PHR1: Protein PHOSPHATE STARVATION RESPONSE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28610`	Transcription factor involved in phosphate starvation signaling.	The Arabidopsis transcription factor PHR1 is essential for adaptation to high light and retaining functional photosynthesis during phosphate starvation.2012 · DOI: 10.1111/j.1399-3054.2011.01520.x
`At5g29000`	Transcription factor acting as central integrator of phosphate starvation responses.	A central regulatory system largely controls transcriptional activation and repression responses to phosphate starvation in Arabidopsis.2010 · DOI: 10.1371/journal.pgen.1001102 Arabidopsis ferritin 1 (AtFer1) gene regulation by the phosphate starvation response 1 (AtPHR1) transcription factor reveals a direct molecular link between iron and phosphate homeostasis.2013 · DOI: 10.1074/jbc.m113.482281
`At3g04450`	Myb family transcription factor PHL13.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8ANX9`	Transcription factor involved in phosphate starvation signaling.	No verified direct reference in this release
`Os03g0329900`	Transcription factor involved in phosphate starvation signaling.	OsPHR2 is involved in phosphate-starvation signaling and excessive phosphate accumulation in shoots of plants.2008 · DOI: 10.1104/pp.107.111443 Integrative Comparison of the Role of the PHOSPHATE RESPONSE1 Subfamily in Phosphate Signaling and Homeostasis in Rice.2015 · DOI: 10.1104/pp.15.00736

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035670 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0034765 regulation of monoatomic ion transmembrane transport Biological Process

GO:0048364 root development Biological Process

GO:0055063 sulfate ion homeostasis Biological Process

GO:0071486 cellular response to high light intensity Biological Process

GO:1901000 regulation of response to salt stress Biological Process

GO:1903842 response to arsenite ion Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G04450

ath:AT4G28610

ath:AT5G29000

dosa:Os03g0329900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · LXL04_035670 · OH-1004

Cytoplasm0.112

Rank 2 · LXL04_035670 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_035670 · OH-1004

Mitochondrion0.011

Rank 4 · LXL04_035670 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_035670 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding187-238 aa

PF14379.12Myb_CC_LHEQLE272-316 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035670	`PF00249.38`	Myb_DNA-binding	187	238	7.7e-10	39.5
LXL04_035670	`PF14379.12`	Myb_CC_LHEQLE	272	316	7.8e-21	74.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CL7`	Arabidopsis thaliana	Protein PHOSPHATE STARVATION RESPONSE 1	49.495%	Swiss-Prot	moderate database homology
`Q8GUN5`	Arabidopsis thaliana	Protein PHR1-LIKE 1	43.432%	Swiss-Prot	moderate database homology
`F4J3P7`	Arabidopsis thaliana	Myb family transcription factor PHL13	48.551%	Swiss-Prot	moderate database homology
`B8ANX9`	Oryza sativa subsp. indica	Protein PHOSPHATE STARVATION RESPONSE 1	49.275%	Swiss-Prot	moderate database homology
`Q10LZ1`	Oryza sativa subsp. japonica	Protein PHOSPHATE STARVATION RESPONSE 1	49.275%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card