LXL04_035629 | RubberDandelionOmics

Gene overview

LXL04_035629

Reference: OH-1004 Chr: Chr08 Coordinates: 25641239-25642478 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

633 bp · LXL04_035629|LXL04_035629|OH1004|cDNA

ATGGTGTCGGCAAATAGGGAGATGGTGGTGTATTGCTTCGATACCCTGGTGGCGCATTACAATGGCGAAGAAGTCCCTCCTCCTGCTTTCGATGAGGGTCAACACCCATTGTTTGTGACTTGGAAGAAAGTTGTGAATGGTTATGAACCTCGTTTACGTGGATGCATTGGAACTCTTGCAGCTCGTGGCATAGTCAATGGTTTTAAGGATTATGCTTTGACCAGTGCTTTGAGGGATCACCGATTCCCTCCCATACAAGC...

CDS

Download CDS FASTA

633 bp · LXL04_035629|LXL04_035629|OH1004|CDS

ATGGTGTCGGCAAATAGGGAGATGGTGGTGTATTGCTTCGATACCCTGGTGGCGCATTACAATGGCGAAGAAGTCCCTCCTCCTGCTTTCGATGAGGGTCAACACCCATTGTTTGTGACTTGGAAGAAAGTTGTGAATGGTTATGAACCTCGTTTACGTGGATGCATTGGAACTCTTGCAGCTCGTGGCATAGTCAATGGTTTTAAGGATTATGCTTTGACCAGTGCTTTGAGGGATCACCGATTCCCTCCCATACAAGC...

Protein

Download Protein FASTA

210 aa · LXL04_035629|LXL04_035629|OH1004|PROTEIN

MVSANREMVVYCFDTLVAHYNGEEVPPPAFDEGQHPLFVTWKKVVNGYEPRLRGCIGTLAARGIVNGFKDYALTSALRDHRFPPIQAKELPLLQCTVSILANYENADNYLDWEVGKHGIIIEFTDPDYNTKRSATYLPDVAAQEGWTVIEAIDSLMRKAGYNGAINDSVRSRIRLTRYQSTLFTMHYNDYVNYVTTTRGVAPSVVGLKAH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035629`
TK1151 ID	TkA04G119370
OH-1004 ID	LXL04_035629
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035629

Location Chr08:25641239-25642478 (+)

Description Similar to At2g38710: Uncharacterized protein At2g38710

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38710`	Uncharacterized protein At2g38710.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035629 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

KEGG gene cross-reference

ath:AT2G38710

cel:CELE_R166.3

hsa:83607

mmu:225339

pon:100171888

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.674

Rank 1 · LXL04_035629 · OH-1004

Nucleus0.632

Rank 2 · LXL04_035629 · OH-1004

Mitochondrion0.041

Rank 3 · LXL04_035629 · OH-1004

Endoplasmic reticulum0.031

Rank 4 · LXL04_035629 · OH-1004

Peroxisome0.029

Rank 5 · LXL04_035629 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01871.23AMMECR110-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035629	`PF01871.23`	AMMECR1	10	183	7.3e-44	149.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVJ2`	Arabidopsis thaliana	Uncharacterized protein At2g38710	75.829%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card