LXL04_035540 | RubberDandelionOmics

Gene overview

LXL04_035540

Reference: OH-1004 Chr: Chr08 Coordinates: 24326437-24328218 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1248 bp · LXL04_035540|LXL04_035540|OH1004|cDNA

ATGTGTTCTCTAACATTTACCCTACCATGTGTGCCACCAAAAATTCCCAATTGTTCCGCTACAGTTGCCCCAAAGACCACCTCTATATCATATTCCGCTCCAGCTAAATTCATCAAGATTCGATTACTGCCTTGTAATTTCACTTGTGCATTATCATCGTCATTGACTACAACAACCAATTGGGTACGAGGGGATAATTCCGAGGAGGATGAAAGGGATTTTGTAGTTGTTAATTTCTACCGGTTTGTGTTCATCAAAAA...

CDS

Download CDS FASTA

1248 bp · LXL04_035540|LXL04_035540|OH1004|CDS

ATGTGTTCTCTAACATTTACCCTACCATGTGTGCCACCAAAAATTCCCAATTGTTCCGCTACAGTTGCCCCAAAGACCACCTCTATATCATATTCCGCTCCAGCTAAATTCATCAAGATTCGATTACTGCCTTGTAATTTCACTTGTGCATTATCATCGTCATTGACTACAACAACCAATTGGGTACGAGGGGATAATTCCGAGGAGGATGAAAGGGATTTTGTAGTTGTTAATTTCTACCGGTTTGTGTTCATCAAAAA...

Protein

Download Protein FASTA

415 aa · LXL04_035540|LXL04_035540|OH1004|PROTEIN

MCSLTFTLPCVPPKIPNCSATVAPKTTSISYSAPAKFIKIRLLPCNFTCALSSSLTTTTNWVRGDNSEEDERDFVVVNFYRFVFIKNPEEEVSKHLQFLQVPFPVFTWIIKLDVMMVGRDIHGRIYINEQGINAQYSGPSEDAITYVNWLKEDERFNDILVQISPPIRNHAFPRLKLRYKPSLLEGGVSHLPLTDSSMRATPLTPAEWRKRLEDRNVILLDVRNGYEWDIGHFRGAQRPNVDCFRSTTFGISESQDIASD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035540`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035540

Location Chr08:24326437-24328218 (+)

Description Similar to STR8: Rhodanese-like domain-containing protein 8, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17850`	Rhodanese-like domain-containing protein 8, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035540 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006400 tRNA modification Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

KEGG gene cross-reference

ath:AT1G17850

cfe:BAE81768.1

cmu:TC_0916

ctr:CT_627

pcu:PC_RS01855

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.939

Rank 1 · LXL04_035540 · OH-1004

Mitochondrion0.075

Rank 2 · LXL04_035540 · OH-1004

Cytoplasm0.039

Rank 3 · LXL04_035540 · OH-1004

Nucleus0.039

Rank 4 · LXL04_035540 · OH-1004

Peroxisome0.019

Rank 5 · LXL04_035540 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17773.8UPF0176_N113-181 aa

PF00581.26Rhodanese204-308 aa

PF12368.14Rhodanese_C318-391 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035540	`PF17773.8`	UPF0176_N	113	181	9e-14	52.3
LXL04_035540	`PF00581.26`	Rhodanese	204	308	4e-12	47.2
LXL04_035540	`PF12368.14`	Rhodanese_C	318	391	1.2e-16	61.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I933`	Arabidopsis thaliana	Rhodanese-like domain-containing protein 8, chloroplastic	56.386%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card