LXL04_035508 | RubberDandelionOmics

Gene overview

LXL04_035508

Reference: OH-1004 Chr: Chr08 Coordinates: 23794206-23797162 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1924 bp · LXL04_035508|LXL04_035508|OH1004|cDNA

ATGGGGCCGTGTTTCGTTTTCCCCCAAGCGATTGAAAATGGATTTTGAAATTGCAGAGCTTAAGCAGAGACAGTGGTGGTTGCCTGCCATGGTTGTTCTAGAGAAGAACCCTAATTCCAAAGCTGAAAATGGCGATGGCTCCAACAGCAAGAAGAAACGAAAGAGgaacaagaacaagaagaaCAATGTAGAGGAAGAGCCTGATATGGCTGCACAAGAAGCAGCAGAAATCAATGGCAGTGAGAAGGAAGAGGAAGAAG...

CDS

Download CDS FASTA

1893 bp · LXL04_035508|LXL04_035508|OH1004|CDS

TTGAAAATGGATTTTGAAATTGCAGAGCTTAAGCAGAGACAGTGGTGGTTGCCTGCCATGGTTGTTCTAGAGAAGAACCCTAATTCCAAAGCTGAAAATGGCGATGGCTCCAACAGCAAGAAGAAACGAAAGAGGAACAAGAACAAGAAGAACAATGTAGAGGAAGAGCCTGATATGGCTGCACAAGAAGCAGCAGAAATCAATGGCAGTGAGAAGGAAGAGGAAGAAGTCACAGCAGTGAAAGAATCGAAAAGGAAGAG...

Protein

Download Protein FASTA

630 aa · LXL04_035508|LXL04_035508|OH1004|PROTEIN

MKMDFEIAELKQRQWWLPAMVVLEKNPNSKAENGDGSNSKKKRKRNKNKKNNVEEEPDMAAQEAAEINGSEKEEEEVTAVKESKRKRKKKEKKAIEEEQNTETDEIKEDEDLNMEEEEVKETETKKKKKVRSGGDSGIMSSDSFTSLPLSEPTKKAIIDMGFQYMTQIQARSIPPLLEGKDVLGAARTGSGKTLAFLIPAVELLYHASFAPRNGTGVVVICPTRELAIQSHAVAKDLLKYHSQTLGLVIGGAARRGEAER...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035508`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035508

Location Chr08:23794206-23797162 (-)

Description Similar to Os03g0802700: DEAD-box ATP-dependent RNA helicase 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18600`	DEAD-box ATP-dependent RNA helicase 51.	No verified direct reference in this release
`At5g65900`	DEAD-box ATP-dependent RNA helicase 27.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0802700`	DEAD-box ATP-dependent RNA helicase 27.	No verified direct reference in this release
`Os06g0535100`	Putative DEAD-box ATP-dependent RNA helicase 51.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035508 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0048866 stem cell fate specification Biological Process

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT3G18600

ath:AT5G65900

ddi:DDB_G0282741

dosa:Os03g0802700

dosa:Os06g0535100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · LXL04_035508 · OH-1004

Cytoplasm0.082

Rank 2 · LXL04_035508 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_035508 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_035508 · OH-1004

Mitochondrion0.014

Rank 5 · LXL04_035508 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD166-337 aa

PF00271.38Helicase_C378-481 aa

PF13959.12CTE_SPB4535-584 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035508	`PF00270.36`	DEAD	166	337	3.5e-47	161.0
LXL04_035508	`PF00271.38`	Helicase_C	378	481	1.6e-24	87.0
LXL04_035508	`PF13959.12`	CTE_SPB4	535	584	8.9e-18	64.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIH9`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 51	66.897%	Swiss-Prot	strong database homology
`Q9SB89`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 27	67.521%	Swiss-Prot	strong database homology
`Q84T03`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 27	68.986%	Swiss-Prot	strong database homology
`Q0DBS1`	Oryza sativa subsp. japonica	Putative DEAD-box ATP-dependent RNA helicase 51	63.333%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card