LXL04_035468 | RubberDandelionOmics

Gene overview

LXL04_035468

Reference: OH-1004 Chr: Chr08 Coordinates: 23146907-23150293 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1218 bp · LXL04_035468|LXL04_035468|OH1004|cDNA

ATGACGAAGACATACCGGAGACGTACAGGAGAAAAGAGGAAATTTGCTAAAACCTCCGCAACCACCATCGCCGGCCTACCCTCGGCGATCGGCGATTTTCAATTTCTTCTGTGGTCGGAGAAGGAAAGAGAAATAAACTTCGAGAGGGTCGTCGATCGATCAATCGATCTAGTCCATCTATCCTATCTACTAGCGTTTCTGGTGATACTGTTAATTCCGGAACTTAATTTTGACAATGAAGAATGCCGAGCGAGCTGCAA...

CDS

Download CDS FASTA

1218 bp · LXL04_035468|LXL04_035468|OH1004|CDS

ATGACGAAGACATACCGGAGACGTACAGGAGAAAAGAGGAAATTTGCTAAAACCTCCGCAACCACCATCGCCGGCCTACCCTCGGCGATCGGCGATTTTCAATTTCTTCTGTGGTCGGAGAAGGAAAGAGAAATAAACTTCGAGAGGGTCGTCGATCGATCAATCGATCTAGTCCATCTATCCTATCTACTAGCGTTTCTGGTGATACTGTTAATTCCGGAACTTAATTTTGACAATGAAGAATGCCGAGCGAGCTGCAA...

Protein

Download Protein FASTA

405 aa · LXL04_035468|LXL04_035468|OH1004|PROTEIN

MTKTYRRRTGEKRKFAKTSATTIAGLPSAIGDFQFLLWSEKEREINFERVVDRSIDLVHLSYLLAFLVILLIPELNFDNEECRASCKYCSSRFNTCTTGCEVFVGCYRSVKPTPPSETMSNEHAMRFPLVGSAMLLSLFLLFKFLSKDLVNAVLTCYFFVLGIIALSATLLPAIRRFLPTKWNEDVITWQFPYFRSLDVEFTRSQVIAGIPGTFFCVWYVAQKHWLANNILGLAFCIQGIEMLSLGSFKTGAILLAGLFF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035468`
TK1151 ID	TkA04G128570
OH-1004 ID	LXL04_035468
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.100
Protein coverage (%)	TK1151 91.789 / OH-1004 77.037 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035468

Location Chr08:23146907-23150293 (+)

Description Similar to SPP: Signal peptide peptidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03120`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane (By similarity).	The signal peptide peptidase is required for pollen function in Arabidopsis.2009 · DOI: 10.1104/pp.108.130252

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0117400`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release
`Os05g0436400`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035468 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006465 signal peptide processing Biological Process

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0033619 membrane protein proteolysis Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:1904211 membrane protein proteolysis involved in retrograde protein transport, ER to cytosol Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005791 rough endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009986 cell surface Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G03120

dosa:Os02g0117400

dosa:Os05g0436400

hsa:81502

mmu:14950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.745

Rank 1 · LXL04_035468 · OH-1004

Golgi apparatus0.123

Rank 2 · LXL04_035468 · OH-1004

Nucleus0.103

Rank 3 · LXL04_035468 · OH-1004

Cytoplasm0.083

Rank 4 · LXL04_035468 · OH-1004

Cell membrane0.061

Rank 5 · LXL04_035468 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04258.19Peptidase_A22B114-386 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035468	`PF04258.19`	Peptidase_A22B	114	386	1.5e-90	304.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81062`	Arabidopsis thaliana	Signal peptide peptidase	80.442%	Swiss-Prot	strong database homology
`Q6ZGL9`	Oryza sativa subsp. japonica	Signal peptide peptidase 1	78.730%	Swiss-Prot	strong database homology
`B9FJ61`	Oryza sativa subsp. japonica	Signal peptide peptidase 2	77.778%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card