LXL04_035452 | RubberDandelionOmics

Gene overview

LXL04_035452

Reference: OH-1004 Chr: Chr08 Coordinates: 22836140-22839078 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1407 bp · LXL04_035452|LXL04_035452|OH1004|cDNA

ATGGGTTGGGGAAGGGCGATTTACGAAGGAATTGTGGTGGTTGGTTCTCTTTCGCTGCTTGCCTGGGCGGGTCTCTGGTTTTTGAACCAAAGACTATACAAAGAGTACGAAGAAAAACGGGTGCTGGTTCAGATCATCTTCAGTGTTGTTTTCGCCCTCTCTTGCAACCTCTTCGAGCTTGTCCTTTTTGAGATCATCCCTATCCTCTCCAAAGAGGCAAGATGGATAAACTGGAAGGTGGATTTATTTTGCTTGATAAC...

CDS

Download CDS FASTA

1407 bp · LXL04_035452|LXL04_035452|OH1004|CDS

ATGGGTTGGGGAAGGGCGATTTACGAAGGAATTGTGGTGGTTGGTTCTCTTTCGCTGCTTGCCTGGGCGGGTCTCTGGTTTTTGAACCAAAGACTATACAAAGAGTACGAAGAAAAACGGGTGCTGGTTCAGATCATCTTCAGTGTTGTTTTCGCCCTCTCTTGCAACCTCTTCGAGCTTGTCCTTTTTGAGATCATCCCTATCCTCTCCAAAGAGGCAAGATGGATAAACTGGAAGGTGGATTTATTTTGCTTGATAAC...

Protein

Download Protein FASTA

468 aa · LXL04_035452|LXL04_035452|OH1004|PROTEIN

MGWGRAIYEGIVVVGSLSLLAWAGLWFLNQRLYKEYEEKRVLVQIIFSVVFALSCNLFELVLFEIIPILSKEARWINWKVDLFCLITLLVFMLPYYHCYLMLCKSGVRKRRAATGAVLFLFAFLYAFWRLGIHFPMPSPDKGFFTIPQLVSRIGVIGVTVMAVLSGFGAVNLPYSYLSLFIREIEEIEIKALERQLMQSIETSIGKKKKIILSQMEMERVQGQEESYKAGSFFKRIVGTVVRSVQDDQKEQDIRGLESEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035452`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035452

Location Chr08:22836140-22839078 (-)

Description Similar to GTG1: GPCR-type G protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64990`	Abscisic acid receptor.	Two novel GPCR-type G proteins are abscisic acid receptors in Arabidopsis.2009 · DOI: 10.1016/j.cell.2008.12.026 G protein-coupled receptor-type G proteins are required for light-dependent seedling growth and fertility in Arabidopsis.2012 · DOI: 10.1105/tpc.112.098681
`At4g27630`	Abscisic acid receptor.	Two novel GPCR-type G proteins are abscisic acid receptors in Arabidopsis.2009 · DOI: 10.1016/j.cell.2008.12.026 G protein-coupled receptor-type G proteins are required for light-dependent seedling growth and fertility in Arabidopsis.2012 · DOI: 10.1105/tpc.112.098681

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XX57`	Involved in chilling tolerance.	No verified direct reference in this release
`Os04g0600800`	Involved in chilling tolerance.	COLD1 confers chilling tolerance in rice.2015 · DOI: 10.1016/j.cell.2015.01.046

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035452 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0015031 protein transport Biological Process

GO:0051452 intracellular pH reduction Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030660 Golgi-associated vesicle membrane Cellular Component

KEGG gene cross-reference

ath:AT1G64990

ath:AT4G27630

dosa:Os04g0600800

gga:418459

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.421

Rank 1 · LXL04_035452 · OH-1004

Golgi apparatus0.370

Rank 2 · LXL04_035452 · OH-1004

Cytoplasm0.190

Rank 3 · LXL04_035452 · OH-1004

Cell membrane0.179

Rank 4 · LXL04_035452 · OH-1004

Nucleus0.090

Rank 5 · LXL04_035452 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12537.14GPHR_N143-209 aa

PF12430.14ABA_GPCR286-456 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035452	`PF12537.14`	GPHR_N	143	209	1.8e-21	76.7
LXL04_035452	`PF12430.14`	ABA_GPCR	286	456	1.2e-43	149.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XIP7`	Arabidopsis thaliana	GPCR-type G protein 1	84.188%	Swiss-Prot	strong database homology
`Q0WQG8`	Arabidopsis thaliana	GPCR-type G protein 2	83.547%	Swiss-Prot	strong database homology
`A2XX57`	Oryza sativa subsp. indica	GPCR-type G protein COLD1	81.838%	Swiss-Prot	strong database homology
`Q7X7S8`	Oryza sativa subsp. japonica	GPCR-type G protein COLD1	82.379%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card