LXL04_035439 | RubberDandelionOmics

Gene overview

LXL04_035439

Reference: OH-1004 Chr: Chr08 Coordinates: 22473383-22476987 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3513 bp · LXL04_035439|LXL04_035439|OH1004|cDNA

ATGGCGTCCAAGTCATTCAAAGCGACTCGCTCAAATCTATCGATAAGCTCCGATGCTACGGATTCACAGCCTAATAAGCCTCCATTGCCGCCGACTGTCACATTCGCCCGCCGGACTTCATCGGGGAGATATGTAAATTATTCAAGGGACGATCTCGACAGTGAACTCGGAAGTCAGGATTTCATGAACTACACAGTCCACCTACCGCCAACTCCCGACAACCAGCCAATGGATGCGATTTCCCAGAAGGTTGAAGAACA...

CDS

Download CDS FASTA

3513 bp · LXL04_035439|LXL04_035439|OH1004|CDS

ATGGCGTCCAAGTCATTCAAAGCGACTCGCTCAAATCTATCGATAAGCTCCGATGCTACGGATTCACAGCCTAATAAGCCTCCATTGCCGCCGACTGTCACATTCGCCCGCCGGACTTCATCGGGGAGATATGTAAATTATTCAAGGGACGATCTCGACAGTGAACTCGGAAGTCAGGATTTCATGAACTACACAGTCCACCTACCGCCAACTCCCGACAACCAGCCAATGGATGCGATTTCCCAGAAGGTTGAAGAACA...

Protein

Download Protein FASTA

1170 aa · LXL04_035439|LXL04_035439|OH1004|PROTEIN

MASKSFKATRSNLSISSDATDSQPNKPPLPPTVTFARRTSSGRYVNYSRDDLDSELGSQDFMNYTVHLPPTPDNQPMDAISQKVEEQYVSSSLFTGGFNAVTRAHLMDKVIDSEINHPQMAGAKGSSCSVPGCDAKVMSDERGADILPCECDFKICRDCYLDAIKTGDGICPGCKEQYKTTDLDELVVDNGTRPLPLPPPAGMSKNERRLSLMKSTKSVLMRSQTGDFDHNRWLFETSGTYGYGNAIWPKEGVMENGKDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035439`
TK1151 ID	TkA04G130920
OH-1004 ID	LXL04_035439
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035439

Location Chr08:22473383-22476987 (-)

Description Similar to CSLD3: Cellulose synthase-like protein D3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03050`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	AtCSLD3, a cellulose synthase-like gene important for root hair growth in arabidopsis.2001 · DOI: 10.1104/pp.126.2.575
`At5g16910`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YU42`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`Os06g0111800`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`Os10g0578200`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	OsCSLD1, a cellulose synthase-like D1 gene, is required for root hair morphogenesis in rice.2007 · DOI: 10.1104/pp.106.091546

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035439 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0048767 root hair elongation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G03050

ath:AT5G16910

dosa:Os06g0111800

dosa:Os10g0578200

osa:4339895

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.527

Rank 1 · LXL04_035439 · OH-1004

Endoplasmic reticulum0.204

Rank 2 · LXL04_035439 · OH-1004

Golgi apparatus0.145

Rank 3 · LXL04_035439 · OH-1004

Cytoplasm0.137

Rank 4 · LXL04_035439 · OH-1004

Lysosome / Vacuole0.093

Rank 5 · LXL04_035439 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14570.13zf-RING_4130-179 aa

PF03552.21Cellulose_synt402-1161 aa

PF13632.13Glyco_trans_2_3860-988 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035439	`PF14570.13`	zf-RING_4	130	179	8.5e-18	64.6
LXL04_035439	`PF03552.21`	Cellulose_synt	402	1161		1256.9
LXL04_035439	`PF13632.13`	Glyco_trans_2_3	860	988	5.9e-06	26.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9M4`	Arabidopsis thaliana	Cellulose synthase-like protein D3	81.857%	Swiss-Prot	strong database homology
`Q9LFL0`	Arabidopsis thaliana	Cellulose synthase-like protein D2	80.681%	Swiss-Prot	strong database homology
`A2YU42`	Oryza sativa subsp. indica	Cellulose synthase-like protein D2	77.666%	Swiss-Prot	strong database homology
`Q9LHZ7`	Oryza sativa subsp. japonica	Cellulose synthase-like protein D2	77.666%	Swiss-Prot	strong database homology
`Q8W3F9`	Oryza sativa subsp. japonica	Cellulose synthase-like protein D1	74.486%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card