LXL04_035414 | RubberDandelionOmics

Gene overview

LXL04_035414

Reference: OH-1004 Chr: Chr08 Coordinates: 22173456-22176024 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1395 bp · LXL04_035414|LXL04_035414|OH1004|cDNA

ATGCGCCATAAGCACCGCACATCCTGCGAAAAGAAACATATTCCCTCGTATACATTCCCAGATGTTCATCCCCTTCACTGGCTCGATGGAACCATGGGAAGACAGAACAGAGGAATTAGCAAAAGAAGGTCATCGAGAATCGATAGTTATCAGATTTCTTCCTCCATTACAGACCCATCTTGTTTTTCGTGTACAACCTTCAATATCCTCGCTCCTATCTACAAACGACTTATTCATGAGGATCGGACTTGCAGAGAAAG...

CDS

Download CDS FASTA

1395 bp · LXL04_035414|LXL04_035414|OH1004|CDS

ATGCGCCATAAGCACCGCACATCCTGCGAAAAGAAACATATTCCCTCGTATACATTCCCAGATGTTCATCCCCTTCACTGGCTCGATGGAACCATGGGAAGACAGAACAGAGGAATTAGCAAAAGAAGGTCATCGAGAATCGATAGTTATCAGATTTCTTCCTCCATTACAGACCCATCTTGTTTTTCGTGTACAACCTTCAATATCCTCGCTCCTATCTACAAACGACTTATTCATGAGGATCGGACTTGCAGAGAAAG...

Protein

Download Protein FASTA

464 aa · LXL04_035414|LXL04_035414|OH1004|PROTEIN

MRHKHRTSCEKKHIPSYTFPDVHPLHWLDGTMGRQNRGISKRRSSRIDSYQISSSITDPSCFSCTTFNILAPIYKRLIHEDRTCRESEIKAYWLDRNERILDLLLRERSSIICLQEFWVNNEELVNMYDTRLGDAGYTIFKLPRTNNRGDGLLTAVHKDHFHVINHKEFLFNDFGDRVAQLLHVEVKNVGREILIVNTHLLFPHDSSMSLERLRQVYKILQFVDAYLKENNLNPLPIILCGDWNGSKRGHVYKFLRSQGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035414`
TK1151 ID	TkA04G132430
OH-1004 ID	LXL04_035414
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 95.425 / OH-1004 94.397 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035414

Location Chr08:22173456-22176024 (-)

Description Similar to At1g02270: Uncharacterized calcium-binding protein At1g02270

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02270`	Uncharacterized calcium-binding protein At1g02270.	No verified direct reference in this release
`At3g18500`	Acts as a catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover.	No verified direct reference in this release
`At1g73875`	Acts as a catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035414 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0008033 tRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0033119 negative regulation of RNA splicing Biological Process

GO:0045930 negative regulation of mitotic cell cycle Biological Process

GO:0070935 3'-UTR-mediated mRNA stabilization Biological Process

GO:0090616 mitochondrial mRNA 3'-end processing Biological Process

GO:2000236 negative regulation of tRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

KEGG gene cross-reference

ath:AT1G02270

ath:AT1G73875

ath:AT3G18500

hsa:90806

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · LXL04_035414 · OH-1004

Nucleus0.255

Rank 2 · LXL04_035414 · OH-1004

Mitochondrion0.153

Rank 3 · LXL04_035414 · OH-1004

Cell membrane0.110

Rank 4 · LXL04_035414 · OH-1004

Endoplasmic reticulum0.102

Rank 5 · LXL04_035414 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03372.30Exo_endo_phos90-292 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035414	`PF03372.30`	Exo_endo_phos	90	292	1.2e-10	42.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81916`	Arabidopsis thaliana	Uncharacterized calcium-binding protein At1g02270	57.489%	Swiss-Prot	strong database homology
`Q9LS39`	Arabidopsis thaliana	Carbon catabolite repressor protein 4 homolog 3	30.000%	Swiss-Prot	weak database homology
`Q0WKY2`	Arabidopsis thaliana	Carbon catabolite repressor protein 4 homolog 5	25.414%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card