LXL04_035287 | RubberDandelionOmics

Gene overview

LXL04_035287

Reference: OH-1004 Chr: Chr08 Coordinates: 19257370-19259094 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1146 bp · LXL04_035287|LXL04_035287|OH1004|cDNA

ATGTGTACAGTGGCGTGGAGTATAAATCGCAAAAAGTCTTGTGAGAATCAAGAAATGAACAAGAGTTCCATGGGTGTGTTAATGGAGAGTCATGATGAAGATGTTAATAGTTCAGAAACAAAGAAAAATAAAGTTATCTGGACACCAGATTTGCATCAGAAGTTCTTGGAAGCCGTTGAAAAGATCGGAGTTCATGccgttccaaaaaaaatcCTAGAACTGATGAAGGTGGAGGGATTAACTAGAGATCACATTGCTAG...

CDS

Download CDS FASTA

1146 bp · LXL04_035287|LXL04_035287|OH1004|CDS

ATGTGTACAGTGGCGTGGAGTATAAATCGCAAAAAGTCTTGTGAGAATCAAGAAATGAACAAGAGTTCCATGGGTGTGTTAATGGAGAGTCATGATGAAGATGTTAATAGTTCAGAAACAAAGAAAAATAAAGTTATCTGGACACCAGATTTGCATCAGAAGTTCTTGGAAGCCGTTGAAAAGATCGGAGTTCATGCCGTTCCAAAAAAAATCCTAGAACTGATGAAGGTGGAGGGATTAACTAGAGATCACATTGCTAG...

Protein

Download Protein FASTA

381 aa · LXL04_035287|LXL04_035287|OH1004|PROTEIN

MCTVAWSINRKKSCENQEMNKSSMGVLMESHDEDVNSSETKKNKVIWTPDLHQKFLEAVEKIGVHAVPKKILELMKVEGLTRDHIASHLQKYRIFLKKIADANNHVEIASKPSLLESSMINEDPWKKLPLISNQPTPQQMNFPSNSVMHEVMNPPVLDTSSFSFPFLKASSCDSTTSSELTHLRSSPNEGYSMQEAIKMSHNSLEDVNKLGIMNSGCVSHMQNLDGFMYDDGGSPSTEMGPFGGVYTNNELHMSWNHECS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035287`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035287

Location Chr08:19257370-19259094 (-)

Description Similar to ARR12: Two-component response regulator ARR12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25180`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	The rate of cell differentiation controls the Arabidopsis root meristem growth phase.2010 · DOI: 10.1016/j.cub.2010.05.035
`At3g16857`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	Two-component circuitry in Arabidopsis cytokinin signal transduction.2001 · DOI: 10.1038/35096500 ARR1, a transcription factor for genes immediately responsive to cytokinins.2001 · DOI: 10.1126/science.1065201 A genetic framework for the control of cell division and differentiation in the root meristem.2008 · DOI: 10.1126/science.1164147
`At3g46640`	Transcription factor that is essential for the generation of the circadian clock oscillation.	PHYTOCLOCK 1 encoding a novel GARP protein essential for the Arabidopsis circadian clock.2005 · DOI: 10.1111/j.1365-2443.2005.00892.x LUX ARRHYTHMO encodes a nighttime repressor of circadian gene expression in the Arabidopsis core clock.2011 · DOI: 10.1016/j.cub.2010.12.021
`At5g59570`	Transcription factor that is a critical component of the regulatory circuit of the circadian clock.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0182100`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035287 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010380 regulation of chlorophyll biosynthetic process Biological Process

GO:0010468 regulation of gene expression Biological Process

KEGG gene cross-reference

ath:AT2G25180

ath:AT3G16857

ath:AT3G46640

ath:AT5G59570

dosa:Os02g0182100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · LXL04_035287 · OH-1004

Cytoplasm0.122

Rank 2 · LXL04_035287 · OH-1004

Cell membrane0.026

Rank 3 · LXL04_035287 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_035287 · OH-1004

Plastid0.011

Rank 5 · LXL04_035287 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding47-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035287	`PF00249.38`	Myb_DNA-binding	47	93	6.2e-09	36.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P62598`	Arabidopsis thaliana	Two-component response regulator ARR12	33.721%	Swiss-Prot	weak database homology
`Q940D0`	Arabidopsis thaliana	Two-component response regulator ARR1	52.564%	Swiss-Prot	weak database homology
`Q9SNB4`	Arabidopsis thaliana	Transcription factor LUX	38.393%	Swiss-Prot	weak database homology
`Q9LTH4`	Arabidopsis thaliana	Transcription factor BOA	50.000%	Swiss-Prot	weak database homology
`Q6H805`	Oryza sativa subsp. japonica	Two-component response regulator ORR24	40.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card