LXL04_035235 | RubberDandelionOmics

Gene overview

LXL04_035235

Reference: OH-1004 Chr: Chr08 Coordinates: 18223615-18224043 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · LXL04_035235|LXL04_035235|OH1004|cDNA

ATGGGATGGGTGATGAAGGAAGTCTTACGATTATACCCATCAGCTCCAAACGTGCAGAGACAAGCATGGGGTGACATTCGAGTAGACCAAGAGTCCATAATCCCAGATGGCACGAACATATGGATCGATGTAGTGGCAATGCACCATGATGTTGATTTTTGGGGCAAAGatgtaaatgaattcaaacCTGAACGGTTCAAGGATGATTTGCATGGTGGATGTCAACATAAAATGGGCTATATACCTTTCGGATTTGGAGG...

CDS

Download CDS FASTA

429 bp · LXL04_035235|LXL04_035235|OH1004|CDS

ATGGGATGGGTGATGAAGGAAGTCTTACGATTATACCCATCAGCTCCAAACGTGCAGAGACAAGCATGGGGTGACATTCGAGTAGACCAAGAGTCCATAATCCCAGATGGCACGAACATATGGATCGATGTAGTGGCAATGCACCATGATGTTGATTTTTGGGGCAAAGATGTAAATGAATTCAAACCTGAACGGTTCAAGGATGATTTGCATGGTGGATGTCAACATAAAATGGGCTATATACCTTTCGGATTTGGAGG...

Protein

Download Protein FASTA

142 aa · LXL04_035235|LXL04_035235|OH1004|PROTEIN

MGWVMKEVLRLYPSAPNVQRQAWGDIRVDQESIIPDGTNIWIDVVAMHHDVDFWGKDVNEFKPERFKDDLHGGCQHKMGYIPFGFGGRMCVGRNLSTMEYKIMLSLILTTFSFSLSPNYTHLPSIMLSLRPMQGLPLIIKPL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035235`
TK1151 ID	TkA04G150440
OH-1004 ID	LXL04_035235
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.183 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035235

Location Chr08:18223615-18224043 (-)

Description Similar to CYP714A2: Cytochrome P450 714A2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24900`	Involved in the inactivation of early gibberellin (GA) intermediates.	Two Arabidopsis cytochrome P450 monooxygenases, CYP714A1 and CYP714A2, function redundantly in plant development through gibberellin deactivation.2011 · DOI: 10.1111/j.1365-313x.2011.04596.x
`At1g67110`	Cytokinin hydroxylase that catalyzes the biosynthesis of trans-zeatin via the isopentenyladenine riboside 5'-monophosphate (iPRMP)-dependent pathway.	Arabidopsis CYP735A1 and CYP735A2 encode cytokinin hydroxylases that catalyze the biosynthesis of trans-Zeatin.2004 · DOI: 10.1074/jbc.m406337200
`At5g24910`	Involved in the inactivation of early gibberellin (GA) intermediates.	Two Arabidopsis cytochrome P450 monooxygenases, CYP714A1 and CYP714A2, function redundantly in plant development through gibberellin deactivation.2011 · DOI: 10.1111/j.1365-313x.2011.04596.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0204700`	Cytochrome P450 involved in brassinosteroids (BRs) inactivation and regulation of BRs homeostasis.	No verified direct reference in this release
`Os01g0388000`	Cytochrome P450 involved in brassinosteroids (BRs) inactivation and regulation of BRs homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035235 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010268 brassinosteroid homeostasis Biological Process

GO:0016131 brassinosteroid metabolic process Biological Process

GO:0033466 trans-zeatin biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT1G67110

ath:AT5G24900

ath:AT5G24910

dosa:Os01g0388000

dosa:Os02g0204700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.548

Rank 1 · LXL04_035235 · OH-1004

Peroxisome0.098

Rank 2 · LXL04_035235 · OH-1004

Mitochondrion0.096

Rank 3 · LXL04_035235 · OH-1004

Cytoplasm0.085

Rank 4 · LXL04_035235 · OH-1004

Nucleus0.032

Rank 5 · LXL04_035235 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p4503-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035235	`PF00067.28`	p450	3	123	1.3e-32	113.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NKZ8`	Arabidopsis thaliana	Cytochrome P450 714A2	46.970%	Swiss-Prot	moderate database homology
`Q9ZW95`	Arabidopsis thaliana	Cytokinin hydroxylase	42.254%	Swiss-Prot	moderate database homology
`Q93Z79`	Arabidopsis thaliana	Cytochrome P450 714A1	41.667%	Swiss-Prot	moderate database homology
`Q6Z6D6`	Oryza sativa subsp. japonica	Cytochrome P450 734A2	39.437%	Swiss-Prot	moderate database homology
`B9X287`	Oryza sativa subsp. japonica	Cytochrome P450 734A6	38.298%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card