LXL04_035220 | RubberDandelionOmics

Gene overview

LXL04_035220

Reference: OH-1004 Chr: Chr08 Coordinates: 17831582-17832868 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

840 bp · LXL04_035220|LXL04_035220|OH1004|cDNA

atgGCTTCCGCGATCTTCAATCCTCCATATTTATCTCACCCTACATCGTCGCCATCAATATCACCCAAAATCGTTAGAAAATCCTCCATTTATGCTTCTCTCTCCAACTCTCAAATTATACGCTCTAAAACCCCAACCATCCGTTCTTTAACATGGGCTCCTCATATTGGTTTAACTCCATTTTCTTCTTGGAATGGCCTCAGGAACAATGGGTTATCAATCTCAATCCAATCTATAAAATTAGAAAAGAGAAAGAAATG...

CDS

Download CDS FASTA

840 bp · LXL04_035220|LXL04_035220|OH1004|CDS

ATGGCTTCCGCGATCTTCAATCCTCCATATTTATCTCACCCTACATCGTCGCCATCAATATCACCCAAAATCGTTAGAAAATCCTCCATTTATGCTTCTCTCTCCAACTCTCAAATTATACGCTCTAAAACCCCAACCATCCGTTCTTTAACATGGGCTCCTCATATTGGTTTAACTCCATTTTCTTCTTGGAATGGCCTCAGGAACAATGGGTTATCAATCTCAATCCAATCTATAAAATTAGAAAAGAGAAAGAAATG...

Protein

Download Protein FASTA

279 aa · LXL04_035220|LXL04_035220|OH1004|PROTEIN

MASAIFNPPYLSHPTSSPSISPKIVRKSSIYASLSNSQIIRSKTPTIRSLTWAPHIGLTPFSSWNGLRNNGLSISIQSIKLEKRKKCKGKGVFASLFGVGAPEALVIGVVALLVFGPKGLADVAKNLGKTLRTFQPTIRELQEVSREFKSTLEKEIGLDELKNPVQGNYTSNIQRQTPPDTLQNSQLTPPPPATTTTTTTDSPATTEETPSVSQDDSGDTTAASPAATMEDSQATDDTKNGSPPSSKVYTSEELLKVTEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035220`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035220

Location Chr08:17831582-17832868 (-)

Description Similar to TATB: Sec-independent protein translocase protein TATB, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52440`	Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across the thylakoid membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0580800`	Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across the thylakoid membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035220 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0009409 response to cold Biological Process

GO:0043953 protein transport by the Tat complex Biological Process

GO:0045038 protein import into chloroplast thylakoid membrane Biological Process

GO:1902458 positive regulation of stomatal opening Biological Process

GO:1903426 regulation of reactive oxygen species biosynthetic process Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009579 thylakoid Cellular Component

KEGG gene cross-reference

ath:AT5G52440

dosa:Os11g0580800

syc:syc1287_c

zma:732790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · LXL04_035220 · OH-1004

Mitochondrion0.025

Rank 2 · LXL04_035220 · OH-1004

Nucleus0.022

Rank 3 · LXL04_035220 · OH-1004

Cytoplasm0.012

Rank 4 · LXL04_035220 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_035220 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02416.22TatA_B_E97-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035220	`PF02416.22`	TatA_B_E	97	142	1.2e-14	54.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XH75`	Arabidopsis thaliana	Sec-independent protein translocase protein TATB, chloroplastic	48.611%	Swiss-Prot	moderate database homology
`Q2R237`	Oryza sativa subsp. japonica	Sec-independent protein translocase protein TATB, chloroplastic	50.276%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card