LXL04_035209 | RubberDandelionOmics

Gene overview

LXL04_035209

Reference: OH-1004 Chr: Chr08 Coordinates: 17630553-17631536 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

984 bp · LXL04_035209|LXL04_035209|OH1004|cDNA

ATGACATCTCTGCAGCTGCTTGCAGAACCATCATCTCTATGTTCTTCAAACTTCATCCATTTCAATCCCCTATACAAAACCCTAACTAAGCCAACAACGAAACCCTACCGGAAACCATCACCCATTCGATCCGTCCTTCAATACAACCGCAAGCCGGAGCTTGCAGGCGAAACCCCAAGGGTCGTCGTCATCACATCTGGCAAAGGTGGTGTAGGAAAAACCACTACCACCGCCAATGTTGGTCTTTCCCTCGCCCGATT...

CDS

Download CDS FASTA

984 bp · LXL04_035209|LXL04_035209|OH1004|CDS

ATGACATCTCTGCAGCTGCTTGCAGAACCATCATCTCTATGTTCTTCAAACTTCATCCATTTCAATCCCCTATACAAAACCCTAACTAAGCCAACAACGAAACCCTACCGGAAACCATCACCCATTCGATCCGTCCTTCAATACAACCGCAAGCCGGAGCTTGCAGGCGAAACCCCAAGGGTCGTCGTCATCACATCTGGCAAAGGTGGTGTAGGAAAAACCACTACCACCGCCAATGTTGGTCTTTCCCTCGCCCGATT...

Protein

Download Protein FASTA

327 aa · LXL04_035209|LXL04_035209|OH1004|PROTEIN

MTSLQLLAEPSSLCSSNFIHFNPLYKTLTKPTTKPYRKPSPIRSVLQYNRKPELAGETPRVVVITSGKGGVGKTTTTANVGLSLARLGFSVVAIDADVGLRNLDLLLGLENRVNYTVVEVLNGDCRLDQALVRDKRWSNFELLCISKPRSKLPLGFGGKALVWLVDALKDRQEGCPDFILIDCPAGIDAGFITAITPANEAVLVTTPDITALRDADRVTGLLECDGIRDIKMIVNRVRTDLIRGEDMMSVLDVQEMLGLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035209`
TK1151 ID	TkA04G154090
OH-1004 ID	LXL04_035209
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035209

Location Chr08:17630553-17631536 (-)

Description Similar to MIND1: Putative septum site-determining protein minD homolog, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24020`	Together with ARC3 and MCD1, regulates FtsZ ring positioning in chloroplasts in an ARC6-dependent manner.	The distinctive roles of five different ARC genes in the chloroplast division process in Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00500.x A homologue of the bacterial cell division site-determining factor MinD mediates placement of the chloroplast division apparatus.2000 · DOI: 10.1016/s0960-9822(00)00466-8 Chloroplast targeting, distribution and transcriptional fluctuation of AtMinD1, a Eubacteria-type factor critical for chloroplast division.2000 · DOI: 10.1093/pcp/pcd037 Overexpression of the Arabidopsis thaliana MinD1 gene alters chloroplast size and number in transgenic tobacco plants.2001 · DOI: 10.1007/s004250100605 Chloroplast division site placement requires dimerization of the ARC11/AtMinD1 protein in Arabidopsis.2004 · DOI: 10.1242/jcs.01092 The plastid division protein AtMinD1 is a Ca2+-ATPase stimulated by AtMinE1.2005 · DOI: 10.1074/jbc.m505126200 The assembly of the FtsZ ring at the mid-chloroplast division site depends on a balance between the activities of AtMinE1 and ARC11/AtMinD1.2008 · DOI: 10.1093/pcp/pcn012 Further evaluation of the localization and functionality of hemagglutinin epitope- and fluorescent protein-tagged AtMinD1 in Arabidopsis thaliana.2009 · DOI: 10.1271/bbb.90309 The chloroplast min system functions differentially in two specific nongreen plastids in Arabidopsis thaliana.2013 · DOI: 10.1371/journal.pone.0071190 Isolation and analysis of a stromule-overproducing Arabidopsis mutant suggest the role of PARC6 in plastid morphology maintenance in the leaf epidermis.2018 · DOI: 10.1111/ppl.12648

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035209 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010020 chloroplast fission Biological Process

GO:0051301 cell division Biological Process

GO:0051782 negative regulation of cell division Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0030899 calcium-dependent ATPase activity Molecular Function

KEGG gene cross-reference

ath:AT5G24020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · LXL04_035209 · OH-1004

Mitochondrion0.029

Rank 2 · LXL04_035209 · OH-1004

Nucleus0.020

Rank 3 · LXL04_035209 · OH-1004

Cytoplasm0.018

Rank 4 · LXL04_035209 · OH-1004

Peroxisome0.013

Rank 5 · LXL04_035209 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10609.16ParA60-298 aa

PF13614.13AAA_3160-213 aa

PF09140.18MipZ60-198 aa

PF01656.30CbiA62-278 aa

PF02374.22ArsA_ATPase62-97 aa

PF00142.25Fer4_NifH66-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035209	`PF10609.16`	ParA	60	298	2e-18	67.5
LXL04_035209	`PF13614.13`	AAA_31	60	213	8.4e-15	55.8
LXL04_035209	`PF09140.18`	MipZ	60	198	5.1e-08	33.3
LXL04_035209	`PF01656.30`	CbiA	62	278	2.1e-20	73.6
LXL04_035209	`PF02374.22`	ArsA_ATPase	62	97	5e-06	26.7
LXL04_035209	`PF00142.25`	Fer4_NifH	66	305	3.4e-08	34.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MBA2`	Arabidopsis thaliana	Septum site-determining protein minD homolog, chloroplastic	94.198%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card