Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1920 bp · LXL04_035203|LXL04_035203|OH1004|cDNA
ATGACCATAGATCGCTTCCAAGAAGAGAACCCGTTGCCATTAAAGACATTGGATACGAGAATATTGCCTGGATTATCTGAAGACCCAAGGAAATATGGGCTGGAAAAATCCACGGAAGTGGATGAGGCGTCGGAACTACTTGGATATCCAAGATCCATAAGAGTGGAATTTTGCAAGTTCCCCGCTTTCCCGCTCATAAAACCTGACAAGCCCTCGGTGCCGATGGACCATGACGTTGCCGCAATGGATGACGTTGATCG...
1920 bp · LXL04_035203|LXL04_035203|OH1004|CDS
ATGACCATAGATCGCTTCCAAGAAGAGAACCCGTTGCCATTAAAGACATTGGATACGAGAATATTGCCTGGATTATCTGAAGACCCAAGGAAATATGGGCTGGAAAAATCCACGGAAGTGGATGAGGCGTCGGAACTACTTGGATATCCAAGATCCATAAGAGTGGAATTTTGCAAGTTCCCCGCTTTCCCGCTCATAAAACCTGACAAGCCCTCGGTGCCGATGGACCATGACGTTGCCGCAATGGATGACGTTGATCG...
Protein
Download Protein FASTA639 aa · LXL04_035203|LXL04_035203|OH1004|PROTEIN
MTIDRFQEENPLPLKTLDTRILPGLSEDPRKYGLEKSTEVDEASELLGYPRSIRVEFCKFPAFPLIKPDKPSVPMDHDVAAMDDVDRLFECFKCGISPPQSATGGRKTKKKKLKQEKSNEDPSTSTDITPANSNGKKQQSATNNQFFTPTVGKKIFNNGSQFSPIVFYGSPQGVPPKRPARDDVWATFPRQDEAMKYAKDHGGVHIFSYQNHATGQRRYKNMNPKFRHHYEVIQEGSPCHLYFDLEFNIKENAEKNGDEM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_035203 |
|---|---|
| TK1151 ID | TkA04G155830 |
| OH-1004 ID | LXL04_035203 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 82.300 |
| Protein coverage (%) | TK1151 98.525 / OH-1004 47.418Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_035203 |
|---|---|
| Location | Chr08:17398905-17402517 (-) |
| Description | Similar to primpol: DNA-directed primase/polymerase protein |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006264 mitochondrial DNA replication Biological Process GO:0006269 DNA replication, synthesis of primer Biological Process GO:0009411 response to UV Biological Process GO:0019985 translesion synthesis Biological Process GO:0031297 replication fork processing Biological Process GO:0042276 error-prone translesion synthesis Biological Process GO:0043504 mitochondrial DNA repair Biological Process GO:0062176 R-loop processing Biological Process GO:0000428 DNA-directed RNA polymerase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005657 replication fork Cellular Component |
| KEGG gene cross-reference | bta:511080 dre:556571 hsa:201973 mmu:408022 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03121.21Herpes_UL52484-536 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_035203 | PF03121.21 | Herpes_UL52 | 484 | 536 | 2.3e-13 | 50.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.