LXL04_035178 | RubberDandelionOmics

Gene overview

LXL04_035178

Reference: OH-1004 Chr: Chr08 Coordinates: 16781439-16789959 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6660 bp · LXL04_035178|LXL04_035178|OH1004|cDNA

ATGTCGGTGGCTTTGAATCATGTTGTTCAGGCTCGGCCCGACCCGGACGTAACAAAATCCTTCGGTTCCCGTCCGTTAAACGGCTTAGCTCGGGTTGGGGTTAGCCGGAGCCGGACATGGGCAAGCCGTGGCTCGGTTGTTAAACAGTCTAGTCTCTTAGGGAAAAGTTTCTACGGGACTAGGCTGCTTCGTGGGTCCGTTTCCGAGACGCTCCATCAATGGAAATCCGATGGTCCTGGCCGTGATCCGAAGCTTAAGGT...

CDS

Download CDS FASTA

6660 bp · LXL04_035178|LXL04_035178|OH1004|CDS

ATGTCGGTGGCTTTGAATCATGTTGTTCAGGCTCGGCCCGACCCGGACGTAACAAAATCCTTCGGTTCCCGTCCGTTAAACGGCTTAGCTCGGGTTGGGGTTAGCCGGAGCCGGACATGGGCAAGCCGTGGCTCGGTTGTTAAACAGTCTAGTCTCTTAGGGAAAAGTTTCTACGGGACTAGGCTGCTTCGTGGGTCCGTTTCCGAGACGCTCCATCAATGGAAATCCGATGGTCCTGGCCGTGATCCGAAGCTTAAGGT...

Protein

Download Protein FASTA

2219 aa · LXL04_035178|LXL04_035178|OH1004|PROTEIN

MSVALNHVVQARPDPDVTKSFGSRPLNGLARVGVSRSRTWASRGSVVKQSSLLGKSFYGTRLLRGSVSETLHQWKSDGPGRDPKLKVVVRSSLSLVPEKPLGLYDPSFDKDACGVGFVAELSGKSNRNTVTDAIEMLVRMSHRGACGCETNTGDGAGILVGLPHDFYKEVAKDEGFELPEPGKYAVGMFFLPTSETRREQSKIVFTKVAESLGHTVLGWRTVPTDNSGLGKSAIQTEPVIEQVFLTPTSRSKADFEQQMY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035178`
TK1151 ID	TkA04G158100
OH-1004 ID	LXL04_035178
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035178

Location Chr08:16781439-16789959 (+)

Description Similar to GLT1: Glutamate synthase 1 [NADH], chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53460`	Involved in glutamate biosynthesis.	Arabidopsis glt1-T mutant defines a role for NADH-GOGAT in the non-photorespiratory ammonium assimilatory pathway.2002 · DOI: 10.1046/j.1365-313x.2002.01218.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0555600`	Involved in glutamate biosynthesis.	No verified direct reference in this release
`Os01g0681900`	Involved in glutamate biosynthesis and plays a major role in the primary ammonium ions assimilation in seedling roots.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035178 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006537 glutamate biosynthetic process Biological Process

GO:0019676 ammonia assimilation cycle Biological Process

GO:0048589 developmental growth Biological Process

GO:0060359 response to ammonium ion Biological Process

GO:0097054 L-glutamate biosynthetic process Biological Process

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005506 iron ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G53460

dosa:Os01g0681900

dosa:Os05g0555600

osa:4324398

spo:2543509

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.361

Rank 1 · LXL04_035178 · OH-1004

Mitochondrion0.254

Rank 2 · LXL04_035178 · OH-1004

Plastid0.180

Rank 3 · LXL04_035178 · OH-1004

Nucleus0.149

Rank 4 · LXL04_035178 · OH-1004

Cell membrane0.069

Rank 5 · LXL04_035178 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00310.27GATase_2113-540 aa

PF04898.21Glu_syn_central590-878 aa

PF01645.24Glu_synthase945-1313 aa

PF01493.26GXGXG1375-1623 aa

PF14691.12Fer4_201729-1840 aa

PF07992.21Pyr_redox_21853-2179 aa

PF00070.34Pyr_redox1854-1888 aa

PF01266.31DAO1854-1888 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035178	`PF00310.27`	GATase_2	113	540	6.2e-184	612.3
LXL04_035178	`PF04898.21`	Glu_syn_central	590	878	4.1e-111	371.6
LXL04_035178	`PF01645.24`	Glu_synthase	945	1313	9.5e-148	493.0
LXL04_035178	`PF01493.26`	GXGXG	1375	1623	5.9e-109	363.9
LXL04_035178	`PF14691.12`	Fer4_20	1729	1840	3.5e-22	79.0
LXL04_035178	`PF07992.21`	Pyr_redox_2	1853	2179	4.1e-27	96.1
LXL04_035178	`PF00070.34`	Pyr_redox	1854	1888	2.3e-07	31.9
LXL04_035178	`PF01266.31`	DAO	1854	1888	8e-07	29.6
LXL04_035178	`PF12831.14`	FAD_oxidored	1855	1895	2e-06	28.1
LXL04_035178	`PF13450.13`	NAD_binding_8	1857	1892	9e-10	39.4
LXL04_035178	`PF01593.31`	Amino_oxidase	1863	1891	6.8e-07	29.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV03`	Arabidopsis thaliana	Glutamate synthase 1 [NADH], chloroplastic	83.610%	Swiss-Prot	strong database homology
`Q0DG35`	Oryza sativa subsp. japonica	Glutamate synthase 2 [NADH], chloroplastic	76.457%	Swiss-Prot	strong database homology
`Q0JKD0`	Oryza sativa subsp. japonica	Glutamate synthase 1 [NADH], chloroplastic	78.279%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card