LXL04_035171 | RubberDandelionOmics

Gene overview

LXL04_035171

Reference: OH-1004 Chr: Chr08 Coordinates: 16267296-16270498 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

693 bp · LXL04_035171|LXL04_035171|OH1004|cDNA

ATGTATGCAGAGAGTGGCTCAATGTTCCATTATTTTGAAAGCTTTTCCCCTGATGCTCAACACTTTACTGATTTCTGTCCCTCACAGAAGTCCAATTCTTGTTTGATCTCTAGTATATCTGATTATGACATTGGATGCGAAGGGGATCTTTTCAAAGCACCTGAACCGATAATCATCGAAGAACCGTTGATTACCCTATATGGAGAAGACATCAATTTTCTAGAAAACAAGTTTACATATCTTGAATCACATAAAGATGA...

CDS

Download CDS FASTA

693 bp · LXL04_035171|LXL04_035171|OH1004|CDS

ATGTATGCAGAGAGTGGCTCAATGTTCCATTATTTTGAAAGCTTTTCCCCTGATGCTCAACACTTTACTGATTTCTGTCCCTCACAGAAGTCCAATTCTTGTTTGATCTCTAGTATATCTGATTATGACATTGGATGCGAAGGGGATCTTTTCAAAGCACCTGAACCGATAATCATCGAAGAACCGTTGATTACCCTATATGGAGAAGACATCAATTTTCTAGAAAACAAGTTTACATATCTTGAATCACATAAAGATGA...

Protein

Download Protein FASTA

230 aa · LXL04_035171|LXL04_035171|OH1004|PROTEIN

MYAESGSMFHYFESFSPDAQHFTDFCPSQKSNSCLISSISDYDIGCEGDLFKAPEPIIIEEPLITLYGEDINFLENKFTYLESHKDEDFTSNLFEEYKDILAGETSSEFPNIKTNDSINVKEILHPFGKFTKRLSYDSLISLDGTQMRPISMNFSELELKNVHGMQRVSSEGYIKPQLMSDQIQETRMQKLSRYRDKKAKRNFGRKIKYACRKALADSQLRIRGRFAKTE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035171`
TK1151 ID	TkA04G160730
OH-1004 ID	LXL04_035171
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035171

Location Chr08:16267296-16270498 (+)

Description Similar to COL12: Zinc finger protein CONSTANS-LIKE 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21880`	Zinc finger protein CONSTANS-LIKE 12.	No verified direct reference in this release
`At1g68520`	Zinc finger protein CONSTANS-LIKE 6.	No verified direct reference in this release
`At1g49130`	Zinc finger protein CONSTANS-LIKE 8.	No verified direct reference in this release
`At1g25440`	Zinc finger protein CONSTANS-LIKE 16.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0240200`	Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035171 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0048577 negative regulation of short-day photoperiodism, flowering Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G25440

ath:AT1G49130

ath:AT1G68520

ath:AT3G21880

dosa:Os09g0240200

osa:4346474

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.544

Rank 1 · LXL04_035171 · OH-1004

Cytoplasm0.498

Rank 2 · LXL04_035171 · OH-1004

Mitochondrion0.054

Rank 3 · LXL04_035171 · OH-1004

Cell membrane0.046

Rank 4 · LXL04_035171 · OH-1004

Endoplasmic reticulum0.029

Rank 5 · LXL04_035171 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06203.20CCT187-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035171	`PF06203.20`	CCT	187	229	6.7e-16	58.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJ44`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 12	48.889%	Swiss-Prot	weak database homology
`Q8LG76`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 6	33.645%	Swiss-Prot	weak database homology
`Q9M9B3`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 8	29.592%	Swiss-Prot	weak database homology
`Q8RWD0`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 16	33.636%	Swiss-Prot	weak database homology
`O82117`	Oryza sativa subsp. japonica	Zinc finger protein CO3	47.170%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card